DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-A and Ada

DIOPT Version :9

Sequence 1:NP_524130.1 Gene:Adgf-A / 39976 FlyBaseID:FBgn0036752 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001258981.1 Gene:Ada / 11486 MGIID:87916 Length:352 Species:Mus musculus


Alignment Length:307 Identity:73/307 - (23%)
Similarity:127/307 - (41%) Gaps:65/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 DYY---------------YKALEEFYEDGVLYLEFR---------SVVPTLYDMDGTEFTPMDTV 299
            |||               |:.:|...::||:|:|.|         .|.|..::....:.||.|.|
Mouse    66 DYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPMPWNQTEGDVTPDDVV 130

  Fly   300 RIYVETLEKFKEAHPDFIGSRMIYAPIRYTNAEGVTGYIQTLKQIKEKYPEFVAGFDLVGQEEM- 363
            .:..:.|::.::|..  |..|.|...:|:..:..    ::.|:..|:...:.|...||.|.|.: 
Mouse   131 DLVNQGLQEGEQAFG--IKVRSILCCMRHQPSWS----LEVLELCKKYNQKTVVAMDLAGDETIE 189

  Fly   364 GRPLRDFVDELLSIPDDIDFY-----------FHAGETNWFGS-TVDENLIDAILLGTKRIGHGF 416
            |..|         .|..::.|           .||||.   || .|....:|  :|.|:|:|||:
Mouse   190 GSSL---------FPGHVEAYEGAVKNGIHRTVHAGEV---GSPEVVREAVD--ILKTERVGHGY 240

  Fly   417 GLVKHPVVLDMLKKLNVAIEVNPISNQVLQLVSDFRNHPCSHFFADGYPVVISSDDPSFWKATPL 481
            ..::...:.:.|.|.|:..||.|.|:.:.........|....|..|.....:::|||..:|:| |
Mouse   241 HTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLIFKST-L 304

  Fly   482 THDFYIA--FLGIASQHSDLRLLKKLALNSIQYSSLTGDAQFEALEK 526
            ..|:.:.  .:|...:.     .|:|.:|:.:.|.|..:.:.|.||:
Mouse   305 DTDYQMTKKDMGFTEEE-----FKRLNINAAKSSFLPEEEKKELLER 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-ANP_524130.1 A_deaminase_N 54..139 CDD:285627
adm_rel 66..538 CDD:273620 73/307 (24%)
ADGF 119..531 CDD:238646 73/307 (24%)
AdaNP_001258981.1 ADA 8..336 CDD:238645 69/295 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2696
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.