DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-B and AAH1

DIOPT Version :9

Sequence 1:NP_649006.2 Gene:Adgf-B / 39975 FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_014258.1 Gene:AAH1 / 855581 SGDID:S000005085 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:74/340 - (21%)
Similarity:130/340 - (38%) Gaps:75/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 HAHDTALCSTDYLISLTYRKNLWICTAEEGCKAIAFRFSKEEPKEKPVKESIWEPMEEFRERRGE 187
            |.|.......|.|..|..|.::.:                  |:..|  :|:.|..|::::.|..
Yeast    16 HLHLEGTLEPDLLFPLAKRNDIIL------------------PEGFP--KSVEELNEKYKKFRDL 60

  Fly   188 ENVTKYLTRRFSMYPFSKFISNNQ-----AWAHFMGIFILLDGLLCHAPIWAEYYYNALKEFAED 247
            ::...|      .|..:..:.:.|     |||:|..:.  ..||     :.||.:|:        
Yeast    61 QDFLDY------YYIGTNVLISEQDFFDLAWAYFKKVH--KQGL-----VHAEVFYD-------- 104

  Fly   248 GVQYLELRSLLPPLYCIDGDMLTIRDTVAIYNSELERFRADHPDFIGSKLIYAPLRGVEPSVVEQ 312
                       |..:...|  ::|......:....::..::..  |.||||...||.:||....:
Yeast   105 -----------PQSHTSRG--ISIETVTKGFQRACDKAFSEFG--ITSKLIMCLLRHIEPEECLK 154

  Fly   313 YVKTAVELNKEFPNFMVGFDLVGQEELGRPLIDFVE---PLLKMPEHINFYFHAGETNWFGSPID 374
            .::.|....|:.....:|.|   ..|...|...|||   ....:.:.:....||||.    .|. 
Yeast   155 TIEEATPFIKDGTISALGLD---SAEKPFPPHLFVECYGKAASLNKDLKLTAHAGEE----GPA- 211

  Fly   375 ENLVDAI-LLGTKRIGHGY-AITKHPMMMRLAKLLGIAIEVCPVSNQVLQLGVDYRNHPAALLLA 437
            :.:.||: ||...||.||. :.....::.||::...: :.:||:||..||:.......|....|.
Yeast   212 QFVSDALDLLQVTRIDHGINSQYDEELLDRLSRDQTM-LTICPLSNVKLQVVQSVSELPLQKFLD 275

  Fly   438 ANVPIVISSDDPSFW 452
            .:||..::||||:::
Yeast   276 RDVPFSLNSDDPAYF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627
adm_rel 56..515 CDD:273620 74/340 (22%)
ADGF 93..507 CDD:238646 74/340 (22%)
AAH1NP_014258.1 aden_deam 10..338 CDD:273619 74/340 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346214
Domainoid 1 1.000 52 1.000 Domainoid score I2828
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.