DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-B and Adal

DIOPT Version :9

Sequence 1:NP_649006.2 Gene:Adgf-B / 39975 FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011238139.1 Gene:Adal / 75894 MGIID:1923144 Length:396 Species:Mus musculus


Alignment Length:298 Identity:75/298 - (25%)
Similarity:117/298 - (39%) Gaps:68/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 NALKEFAEDGVQYLELRSLLPPLYCIDGDMLTIRDTVAIYNSELERFRADHPDFIGSKLIYAPLR 303
            :.:||||:|||:|||||| .|......|  :|.:..|......:::.:.::.|.....|:....|
Mouse    88 DVIKEFADDGVKYLELRS-TPREENATG--MTRKTYVESVLEGIKQCKQENLDIDVRYLMAIDRR 149

  Fly   304 GVEPSVVEQYVKTAVELNKEF----PNFMVGFDLVGQEELGRPLIDFVEPLLKMPE-HINFYFHA 363
            | .|::..:    .|||.|||    .|.::|.||.|...:|: ..||:||||:..: .:....|.
Mouse   150 G-GPTIARE----TVELAKEFFLSTENTVLGLDLSGDPTIGQ-ANDFLEPLLEAKKAGLKLALHL 208

  Fly   364 GETNWFGSPIDENLVDAIL-LGTKRIGHG--------------------------------YAIT 395
            .|.     |..|.....:| |...|||||                                |...
Mouse   209 AEI-----PNREKENQMLLSLLPDRIGHGTFLSASEAGALDQVDFVRQHQIPLVLEANAELYMCR 268

  Fly   396 KHPMMMR--------LAKLLGIAIEVCPVSNQVLQLGVDYRNHPAALLLAANVPIVISSDDPSFW 452
            ..|:::|        .::::.|..|:|..||...|....|..|......:...|.||.:||...:
Mouse   269 AGPLLLRHIPTQNKSTSQVMNILWELCLTSNIKSQTVPSYDQHHFGFWYSIAHPSVICTDDKGVF 333

  Fly   453 HCAPLSHDFYFA--FLGIAPMKADLRFLKSLAINSIRY 488
             ...||.::..|  ...:.|.:     :..|:..||.|
Mouse   334 -ATYLSQEYQLAAETFNLTPFQ-----VWDLSYESINY 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627
adm_rel 56..515 CDD:273620 75/298 (25%)
ADGF 93..507 CDD:238646 75/298 (25%)
AdalXP_011238139.1 ADA_AMPD 17..380 CDD:238250 75/298 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.