DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-B and ada

DIOPT Version :9

Sequence 1:NP_649006.2 Gene:Adgf-B / 39975 FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_031749914.1 Gene:ada / 496434 XenbaseID:XB-GENE-950501 Length:365 Species:Xenopus tropicalis


Alignment Length:293 Identity:73/293 - (24%)
Similarity:115/293 - (39%) Gaps:68/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 YNALKEFAEDGVQYLELR--------SLLPPLYC--IDGDMLTIRDTVAIYNSELERFRADHPDF 292
            |..::..|::||.|:|:|        |.:.|:..  .:|| :|..:.|.:.|..|.:        
 Frog    90 YEFVEMKAKEGVIYVEVRYSPHFLANSKVEPIPWGQKEGD-ITPDEVVDLVNQGLRK-------- 145

  Fly   293 IGSKLIYAPLRGV------EPSVVEQYVKTAVELNKEFPN-FMVGFDLVGQEELGRPLIDFVEPL 350
             |.|......|.:      .||    :....|||.|::.| .:|..||.|.|.|.         .
 Frog   146 -GEKAFNIKARSILCCMRHMPS----WSTEVVELCKKYQNDTVVAIDLAGDESLN---------C 196

  Fly   351 LKMPEHINFY-----------FHAGETNWFGSPIDENLVDAILLGTKRIGHGYAITKHPMMMRLA 404
            ...|.|...|           .||||..  .|.:.:..|:  :|..:||||||..|:.|.:.:..
 Frog   197 ESYPGHRKAYEEAVKCGIHRTVHAGEVG--PSSVVKEAVE--VLKAERIGHGYHTTEDPNLYKEL 257

  Fly   405 KLLGIAIEVCPVSNQVLQLGV---DYRNHPAALLLAANVPIVISSDDPSFWHCAPLSHDFYFA-- 464
            ....:..||||.|:.:  .|.   |:..|||...........:::|||..:. :.|..|:..|  
 Frog   258 LEKNMHFEVCPWSSYL--TGACHPDFTKHPATQFRKDKANYSLNTDDPLIFG-STLDVDYSIAAK 319

  Fly   465 FLGIAPMKADLRFLKSLAINSIRYSALVGEEKR 497
            .:|....:     .|.:.||:.:.|.|...||:
 Frog   320 HMGFTEEE-----FKRVNINAAKSSFLPESEKK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627
adm_rel 56..515 CDD:273620 73/293 (25%)
ADGF 93..507 CDD:238646 73/293 (25%)
adaXP_031749914.1 ADA 17..353 CDD:238645 73/293 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.