DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-B and AMPdeam

DIOPT Version :9

Sequence 1:NP_649006.2 Gene:Adgf-B / 39975 FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001285233.1 Gene:AMPdeam / 32352 FlyBaseID:FBgn0052626 Length:798 Species:Drosophila melanogaster


Alignment Length:383 Identity:96/383 - (25%)
Similarity:144/383 - (37%) Gaps:123/383 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 NVTKY-LT--------RRFSMYPFSKFIS--NNQAWAHFMGIFILLDGLLCHAPIWAEYYYNALK 242
            |:|.| ||        .|.:.:.|.||.|  |....:....:|:..|..|.     .:|:...:|
  Fly   393 NLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLN-----GKYFAQIIK 452

  Fly   243 EFA----EDGVQYLELRSLL----P------PLYCIDGDMLTIRDTVAIYNSELERFRADHPD-- 291
            |.|    |...|..|||..:    |      ..:.||.|         :|:|.: |:....|.  
  Fly   453 EVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDND---------VYSSNI-RWLIQIPRLF 507

  Fly   292 --FIGSKL----------IYAPLRGVEPSVVEQYVKTA-----VELNKEFPNFMVGFDLVGQE-E 338
              |..:|:          |:.||          :..||     .||:: |..:::|||.|..| :
  Fly   508 DIFKSNKMMKSFQEILNNIFLPL----------FEATARPSKHPELHR-FLQYVIGFDSVDDESK 561

  Fly   339 LGRPLIDFVEPLLKMPE-----------HINFYFHAGET-----------NWF--------GSPI 373
            ...||.|...|   .||           :..:|.:|..|           |.|        ..|:
  Fly   562 PENPLFDNDVP---RPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPV 623

  Fly   374 DENLVDAILLGTKRIGHGYAITKHPMMMRLAKLLGIAIEVCPVSNQVLQLGVDYRNHPAALLLAA 438
             ::||...|: .:.|.||..:.|.|::..|..|..|.|.:.|:||..|.|  :|..:|....||.
  Fly   624 -QHLVCGFLM-AENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFL--NYHRNPLPEYLAR 684

  Fly   439 NVPIVISSDDPSFWHCA--PLSHDFYFAFLGIAPMKADLRFLKS-----LAINSIRYS 489
            .:.|.:|:|||..:|..  ||..::..|        |.:..|.|     ||.||:..|
  Fly   685 GLIISLSTDDPLQFHFTKEPLMEEYSIA--------AQVWKLSSCDMCELARNSVMMS 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627
adm_rel 56..515 CDD:273620 96/383 (25%)
ADGF 93..507 CDD:238646 96/383 (25%)
AMPdeamNP_001285233.1 PLN03055 248..784 CDD:178613 96/383 (25%)
AMPD 284..780 CDD:238644 96/383 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.