DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-B and Adal

DIOPT Version :9

Sequence 1:NP_649006.2 Gene:Adgf-B / 39975 FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_008760388.1 Gene:Adal / 311352 RGDID:1359517 Length:360 Species:Rattus norvegicus


Alignment Length:261 Identity:72/261 - (27%)
Similarity:110/261 - (42%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 NALKEFAEDGVQYLELRSLLPPLYCIDGDMLTIRDTVAIYNSELE---RFRADHPDFIGSKLIYA 300
            :.:||||:|||:||||||  .|    .|:..|.........|.||   :.:.::.| |..:.:.|
  Rat    88 DVIKEFADDGVKYLELRS--TP----RGENATGMTRKTYVESVLEGIKQCKQENLD-IDVRYLMA 145

  Fly   301 PLRGVEPSVVEQYVKTAVELNKEFPNFMVGFDLVGQEELGRPLIDFVEPLLKMPE-HINFYFHAG 364
            ..|...|:|.::.||.|.|......:.::|.||.|...:|:.. ||:||||:..: .:....|..
  Rat   146 IDRKGGPTVAKETVKLAKEFFLSAEDTVLGLDLSGDPTIGQAK-DFLEPLLEAKKAGLKLALHLA 209

  Fly   365 ETNWFGSPIDENLVDAIL-LGTKRIGHGYAITKHPM----MMRLAKLLGIAIEVCPVSNQVLQLG 424
            |.     |..|.....:| |...|||||..:.....    .:...:...|.:|:|..||...|..
  Rat   210 EI-----PNKEKETQMLLDLLPDRIGHGTFLNTPEAGSVDQVNFVRQHRIPLELCLTSNIKSQTV 269

  Fly   425 VDYRNHPAALLLAANVPIVISSDDPSFWHCAPLSHDFYFA--FLGIAPMKADLRFLKSLAINSIR 487
            ..|..|......:...|.||.:||...: ...||.::..|  ...:.|.:     :..|:..||.
  Rat   270 PSYDQHHFGFWYSVAHPSVICTDDKGVF-ATSLSQEYQLAAETFNLTPSQ-----VWDLSYESIN 328

  Fly   488 Y 488
            |
  Rat   329 Y 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627
adm_rel 56..515 CDD:273620 72/261 (28%)
ADGF 93..507 CDD:238646 72/261 (28%)
AdalXP_008760388.1 ADA_AMPD 17..344 CDD:238250 72/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.