DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-B and Ampd1

DIOPT Version :9

Sequence 1:NP_649006.2 Gene:Adgf-B / 39975 FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001028475.2 Gene:Ampd1 / 229665 MGIID:88015 Length:745 Species:Mus musculus


Alignment Length:392 Identity:87/392 - (22%)
Similarity:140/392 - (35%) Gaps:112/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 EENVT-KYLTRRFSMYP----------------FSKFISNNQAW-----AHFMGIFILLDGLLCH 229
            |:::| |.|..:.:|:|                |.:|...|..:     :....:::..|..   
Mouse   334 EKSLTLKELFAKLNMHPYDLTVDSLDVHAGRQTFQRFDKFNDKYNPVGASELRDLYLKTDNY--- 395

  Fly   230 APIWAEYYYNALKEFAEDGV----QYLELRSLL----PP-------------LYCIDGDMLTIRD 273
              |..||:...:||...|.|    |:.|.|..:    |.             :||  .:|..:..
Mouse   396 --INGEYFATIIKEVGADLVEAKYQHAEPRLSIYGRSPDEWNKLSSWFVCNRIYC--PNMTWMIQ 456

  Fly   274 TVAIYNSELERFRADH--PDFIGSKL--IYAPLRGVEPSVVEQ-YVKTAVELNKEFPNFMVGFDL 333
            ...||    :.||:.:  |.| |..|  |:.|:  .|.::..| :...:|     |...:.|||.
Mouse   457 VPRIY----DVFRSKNFLPHF-GKMLENIFLPV--FEATINPQAHPDLSV-----FLKHITGFDS 509

  Fly   334 VGQE----------ELGRP--------------------LIDFVEPLLKMPEHINFYF--HAGET 366
            |..|          :..:|                    .|..:..|.|......|.|  |.||.
Mouse   510 VDDESKHSGHMFSSKSPKPEEWTMENNPSYTYYAYYMYANITVLNSLRKERGMNTFLFRPHCGEA 574

  Fly   367 NWFGSPIDENLVDAILLGTKRIGHGYAITKHPMMMRLAKLLGIAIEVCPVSNQVLQLGVDYRNHP 431
            ...     .:|:.|.:: ...|.||..:.|.|::..|..|..|.|.:.|:||..|.|  :|..:|
Mouse   575 GAL-----THLMTAFMI-ADNISHGLNLKKSPVLQYLFFLAQIPIAMSPLSNNSLFL--EYAKNP 631

  Fly   432 AALLLAANVPIVISSDDPSFWHCA--PLSHDFYFAFLGIAPMKADLRFLKSLAINSIRYSALVGE 494
            ....|...:.|.:|:|||..:|..  ||..::..|   ....|.....:..:|.||:....:..|
Mouse   632 FLDFLQKGLMISLSTDDPMQFHFTKEPLMEEYAIA---AQVFKLSTCDMCEVARNSVLQCGISHE 693

  Fly   495 EK 496
            ||
Mouse   694 EK 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627
adm_rel 56..515 CDD:273620 87/392 (22%)
ADGF 93..507 CDD:238646 87/392 (22%)
Ampd1NP_001028475.2 PLN03055 129..740 CDD:178613 87/392 (22%)
AMPD 238..734 CDD:238644 87/392 (22%)
Substrate binding. /evidence=ECO:0000250 372..377 1/4 (25%)
Substrate binding. /evidence=ECO:0000250 648..651 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.