DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adgf-B and Ampd3

DIOPT Version :9

Sequence 1:NP_649006.2 Gene:Adgf-B / 39975 FlyBaseID:FBgn0036751 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001359370.1 Gene:Ampd3 / 11717 MGIID:1096344 Length:775 Species:Mus musculus


Alignment Length:390 Identity:85/390 - (21%)
Similarity:128/390 - (32%) Gaps:128/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 RFSMYPFSKFIS--NNQAWAHFMGIFILLDGLLCHAPIWAEYYYNALKEFA---EDG-VQYLELR 255
            |.:.:.|.||.|  |....:....:::..:..|     ..||:...:||.|   ||. .||.|.|
Mouse   388 RQTFHRFDKFNSKYNPVGASELRDLYLKTENYL-----GGEYFARMVKEVARELEDSKYQYSEPR 447

  Fly   256 SLLPPLYCIDGDMLTIRDTVAIYN------SELERFRADHPDFIGSKLIYAP-LRGV--EPSVVE 311
                               ::||.      |.|.|:...|.       :|:| :|.:  .|.:.:
Mouse   448 -------------------LSIYGRSPKEWSSLARWFIQHK-------VYSPNMRWIIQVPRIYD 486

  Fly   312 QYVKTAVELNKEFPNF------------------------------MVGFDLVGQEEL------- 339
            .:     ...|..|||                              :.|||.|..|..       
Mouse   487 IF-----RSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFS 546

  Fly   340 -GRPLIDFVEPLLKMPEHINFYF------------------------HAGETNWFGSPIDENLVD 379
             ..|..|........|.....|:                        |.||.   ||  ..:||.
Mouse   547 DKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEA---GS--ITHLVS 606

  Fly   380 AILLGTKRIGHGYAITKHPMMMRLAKLLGIAIEVCPVSNQVLQLGVDYRNHPAALLLAANVPIVI 444
            |.|. ...|.||..:.|.|::..|..|..|.|.:.|:||..|.|  :|..:|....|...:.:.:
Mouse   607 AFLT-ADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFL--EYSKNPLREFLHKGLHVSL 668

  Fly   445 SSDDPSFWHCA--PLSHDFYFAFLGIAPMKADLRFLKSLAINSIRYSALVGEEKR--VGYRKWQE 505
            |:|||..:|..  .|..::..|   ....|.....|..:|.||:..|.|..:||:  :|...::|
Mouse   669 STDDPMQFHYTKEALMEEYAIA---AQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKE 730

  Fly   506  505
            Mouse   731  730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adgf-BNP_649006.2 A_deaminase_N 36..113 CDD:285627
adm_rel 56..515 CDD:273620 85/390 (22%)
ADGF 93..507 CDD:238646 85/390 (22%)
Ampd3NP_001359370.1 AMP_deaminase 155..761 CDD:273618 85/390 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.