DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6034 and paox

DIOPT Version :9

Sequence 1:NP_649005.1 Gene:CG6034 / 39974 FlyBaseID:FBgn0036750 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001011373.1 Gene:paox / 496840 XenbaseID:XB-GENE-946701 Length:301 Species:Xenopus tropicalis


Alignment Length:329 Identity:89/329 - (27%)
Similarity:133/329 - (40%) Gaps:92/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IVIIGAGASGVAAATKLLEQGFKNVLLFEAEDRIGGRINTILFANSLIDLGAQWCHG-EEGNVVY 82
            ::|||||.||:|||.||.|:||:|..:.||..|.||||.:..:|..|:::||||.|| ...|.|:
 Frog     8 VLIIGAGISGLAAAQKLHERGFRNFRILEATGRSGGRIRSRKYAKGLVEIGAQWIHGPSPSNPVF 72

  Fly    83 EKVKDLDVLDRTGDYVVHFIRSNKEILTDVHNKALTELTNAFEVPGEHEGSV-----GDAFNAYW 142
            :.....::|.                     ::||:|.....|:.|....||     |...|...
 Frog    73 QLSTQYNLLS---------------------SEALSEENQLVELEGHPMFSVIYSSSGKQINRGV 116

  Fly   143 KENIHQLVPNDKTIAKE-----------AQDCLKKVICSMDACDNLSELSYRNFR------NFAI 190
            .||:.::..:....::|           ....|::.||:          ||.|:.      ..|:
 Frog   117 GENVVEMFSSWLQKSREFTKGGCNPEESVGSFLRQEICN----------SYSNWERDSLELKMAL 171

  Fly   191 AGGDQNLSWRQKGYWKFLSVLLNSSDNQPGDQGILKG-----------------------HVHLN 232
            ..|...|.....|......|.|:|.    |:..:|.|                       :|.||
 Frog   172 LSGLFKLECCISGTHSMDYVALSSC----GEYEMLPGLDCTFPRGYESLVDHIKASFPSDNVLLN 232

  Fly   233 KRIAKINWEG-----DGEL---TLRCWNGQFVSADHVICTVSLG---VLREKHHKLFVPALPASK 286
            |.:..|||:|     |..:   .:.|.||:...|||||.||.||   |:.|.:.|:....|..::
 Frog   233 KPVKTINWKGSFSGSDSRIYPVQVECENGETFVADHVILTVPLGIGPVIWENYGKVISHRLHCNE 297

  Fly   287 IRSI 290
            |..|
 Frog   298 IIKI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6034NP_649005.1 Amino_oxidase 33..470 CDD:279874 79/315 (25%)
NAD_binding_8 <35..88 CDD:290186 22/53 (42%)
paoxNP_001011373.1 Amino_oxidase 6..>277 CDD:332356 82/303 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375579at33208
OrthoFinder 1 1.000 - - FOG0000632
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X429
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.