DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7460 and paox

DIOPT Version :9

Sequence 1:NP_001261998.1 Gene:CG7460 / 39973 FlyBaseID:FBgn0036749 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001011373.1 Gene:paox / 496840 XenbaseID:XB-GENE-946701 Length:301 Species:Xenopus tropicalis


Alignment Length:325 Identity:82/325 - (25%)
Similarity:123/325 - (37%) Gaps:122/325 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IVIVGAGSAGIAAATRLLDLGFRNVLLLEAEDRIGGRVHTIPFADNVVDLGAQWCHG-EKGNVVY 81
            ::|:|||.:|:|||.:|.:.||||..:|||..|.|||:.:..:|..:|::||||.|| ...|.|:
 Frog     8 VLIIGAGISGLAAAQKLHERGFRNFRILEATGRSGGRIRSRKYAKGLVEIGAQWIHGPSPSNPVF 72

  Fly    82 DKVKDLNLLEVTEPHYETFRCVRSNKEVLPDDLADQLKTIADMSIPDRQAELLDFEG-------- 138
            ......|||               :.|.|.:                 :.:|::.||        
 Frog    73 QLSTQYNLL---------------SSEALSE-----------------ENQLVELEGHPMFSVIY 105

  Fly   139 -SLGDYINMKYWKELAKLPPIDRTIAEEFLEVFHKF----------------------------- 173
             |.|..||              |.:.|..:|:|..:                             
 Frog   106 SSSGKQIN--------------RGVGENVVEMFSSWLQKSREFTKGGCNPEESVGSFLRQEICNS 156

  Fly   174 ---------EASVEAADHLFE----VSGKGHLEYWL---CEGELLLNWKD----KGYKRFLKLLM 218
                     |..:.....||:    :||...::|..   |....:|...|    :||:..:..: 
 Frog   157 YSNWERDSLELKMALLSGLFKLECCISGTHSMDYVALSSCGEYEMLPGLDCTFPRGYESLVDHI- 220

  Fly   219 KAPEDQSEDLGILKDHVRLNRRIAEINWKGADE--------LTVRCWNGEVITADHVICTVSLGV 275
            ||        ....|:|.||:.:..|||||:..        :.|.|.|||...|||||.||.||:
 Frog   221 KA--------SFPSDNVLLNKPVKTINWKGSFSGSDSRIYPVQVECENGETFVADHVILTVPLGI 277

  Fly   276  275
             Frog   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7460NP_001261998.1 Amino_oxidase 32..476 CDD:279874 74/311 (24%)
NAD_binding_8 33..>74 CDD:290186 18/40 (45%)
paoxNP_001011373.1 Amino_oxidase 6..>277 CDD:332356 81/323 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375579at33208
OrthoFinder 1 1.000 - - FOG0000632
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X429
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.