DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7460 and KDM1A

DIOPT Version :9

Sequence 1:NP_001261998.1 Gene:CG7460 / 39973 FlyBaseID:FBgn0036749 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_006710537.1 Gene:KDM1A / 23028 HGNCID:29079 Length:878 Species:Homo sapiens


Alignment Length:611 Identity:156/611 - (25%)
Similarity:244/611 - (39%) Gaps:201/611 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TRQTARIVIVGAGSAGIAAATRLLDLGFRNVLLLEAEDRIGGRVHTIPFADNVVDLGAQWCHGEK 76
            |::|.:::|:|:|.:|:|||.:|...|. :|.||||.||:||||.|....:.|.||||....|..
Human   295 TKKTGKVIIIGSGVSGLAAARQLQSFGM-DVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLG 358

  Fly    77 GN--VVYDKVKDLNLLEVTE--PHYETFRCVRSNKEVLP---DDLADQ-----LKTIADMSIPDR 129
            ||  .|..|..::.|.::.:  |.||      :|.:.:|   |::.:|     |:..:.:|    
Human   359 GNPMAVVSKQVNMELAKIKQKCPLYE------ANGQAVPKEKDEMVEQEFNRLLEATSYLS---- 413

  Fly   130 QAELLDFE------GSLGDYI--------------NMKYWKELAKL------------------- 155
              ..|||.      .|||..:              .:::||::.|.                   
Human   414 --HQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIK 476

  Fly   156 -------------PPIDRTIAEEFLEVFHK-FEASVEAADHLFEVSGKGHLEYWLCEGEL----- 201
                         ||.|.| ||..::..|: ..|..:..|.|.|..||  ||..|.|.|.     
Human   477 ELHQQYKEASEVKPPRDIT-AEFLVKSKHRDLTALCKEYDELAETQGK--LEEKLQELEANPPSP 538

  Fly   202 ---------------LLNWKDKGYKRF-----LKLLMKAPEDQSEDLGILKDH------------ 234
                           :|:|.....: |     |..|.....||.:|......|            
Human   539 LFFCSDVYLSSRDRQILDWHFANLE-FANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPV 602

  Fly   235 -------VRLNRRIAEINW--KGADELTVRCWNGE---VITADHVICTVSLGVLKEQHPKL-FVP 286
                   ::||..:.::.:  .|.:.:.|...:..   :...|.|:||:.|||||:|.|.: |||
Human   603 ALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVP 667

  Fly   287 ALPAAKVRAIEGLKLGTVDKFFLEFENPPLPGDWPGFNCLWLKEDLEELRASELFWLESV--FG- 348
            .||..|..|::.:..|.::|..|.|:                          .:||..||  || 
Human   668 PLPEWKTSAVQRMGFGNLNKVVLCFD--------------------------RVFWDPSVNLFGH 706

  Fly   349 -------------FYPVSRQPRILQGWIIGPHARHMETLTEE-------RVLEGLLWLFRKFLPF 393
                         |:.:.:.| ||...:.|..|..||.::::       .:|:|:      |...
Human   707 VGSTTASRGELFLFWNLYKAP-ILLALVAGEAAGIMENISDDVIVGRCLAILKGI------FGSS 764

  Fly   394 ETAHPVRMLRTQWHANPNFRGSYTFRSTYTDALRTG-AWDLEA----PLQDVCGR----PRLQFA 449
            ....|...:.::|.|:|..||||    :|..|..:| .:||.|    |...:.|.    |||.||
Human   765 AVPQPKETVVSRWRADPWARGSY----SYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFA 825

  Fly   450 GESTHKHFYSTVHGAVETGWREAERL 475
            ||.|.:::.:|||||:.:|.|||.|:
Human   826 GEHTIRNYPATVHGALLSGLREAGRI 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7460NP_001261998.1 Amino_oxidase 32..476 CDD:279874 147/591 (25%)
NAD_binding_8 33..>74 CDD:290186 19/40 (48%)
KDM1AXP_006710537.1 SWIRM 197..284 CDD:282311
NAD_binding_8 303..361 CDD:290186 28/58 (48%)
Amino_oxidase 308..851 CDD:279874 150/596 (25%)
SurA_N_3 <395..491 CDD:304439 13/101 (13%)
NAT_SF <441..>549 CDD:302625 21/110 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.