DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6052 and CAF16

DIOPT Version :9

Sequence 1:NP_649002.3 Gene:CG6052 / 39971 FlyBaseID:FBgn0036747 Length:1725 Species:Drosophila melanogaster
Sequence 2:NP_116625.1 Gene:CAF16 / 850516 SGDID:S000001866 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:67/288 - (23%)
Similarity:112/288 - (38%) Gaps:65/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1351 MINSGRKDVPLLVYKISKRYRSKLAVKAISFHVPHAECFGLLGINGAGKTSTFKMLAGDEKITSG 1415
            |::....:|..|.||..:  .|..:|..|:..:|......::|.|||||::..|:|:|......|
Yeast     1 MVSQFAIEVRNLTYKFKE--SSDPSVVDINLQIPWNTRSLVVGANGAGKSTLLKLLSGKHLCLDG 63

  Fly  1416 EAYIDGTN----ISTHKVYRKIGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAI- 1475
            :..::|.:    :|.::|        ..|...||.|..:|....    |.:..|::.|...:.: 
Yeast    64 KILVNGLDPFSPLSMNQV--------DDDESVEDSTNYQTTTYL----GTEWCHMSIINRDIGVL 116

  Fly  1476 ----SFGFAKHMDK--------------QTKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDP 1522
                |.||....::              :....|.|.:|::..|:.:|....||.|||.|..:|.
Yeast   117 ELLKSIGFDHFRERGERLVRILDIDVRWRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDV 181

  Fly  1523 AARRQL-----WQIIGLIRTAGKSIVLTSHSMD------------ECEALCSRLAIMVDGEF--- 1567
            .||.:|     |:    ..|...|:|..:|..|            :...:...|....|.||   
Yeast   182 IARARLLEFLKWE----TETRRCSVVYATHIFDGLAKWPNQVYHMKSGKIVDNLDYQKDVEFSEV 242

  Fly  1568 ---KCLGSVQSLKNQFSKGLILKVKVKH 1592
               |..|.| :.:|..:|.:|.||...|
Yeast   243 VNAKVNGQV-AFENDNNKVVISKVNSLH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6052NP_649002.3 rim_protein 21..>54 CDD:130324
rim_protein <149..1709 CDD:130324 67/288 (23%)
CAF16NP_116625.1 COG4586 1..289 CDD:226952 67/288 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3774
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46598
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.