DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6052 and Abcg8

DIOPT Version :9

Sequence 1:NP_649002.3 Gene:CG6052 / 39971 FlyBaseID:FBgn0036747 Length:1725 Species:Drosophila melanogaster
Sequence 2:NP_080456.1 Gene:Abcg8 / 67470 MGIID:1914720 Length:673 Species:Mus musculus


Alignment Length:359 Identity:80/359 - (22%)
Similarity:147/359 - (40%) Gaps:83/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1361 LLVYKISKRYRS-----KLAVKAISFHVPHAECFGLLGINGAGKTSTFKMLAG---DEKITSGEA 1417
            |..:||..|..|     :|.::.:||.|...:...::|.:|.|:.|...::.|   ..|:.||:.
Mouse    69 LAQFKIPWRSHSSQDSCELGIRNLSFKVRSGQMLAIIGSSGCGRASLLDVITGRGHGGKMKSGQI 133

  Fly  1418 YIDGTNISTHKVYRK-IGYCPQFDALFEDLTGRETLNIYCLLRGVQRRHVTPICWGLAISFGFAK 1481
            :|:| ..||.::.|| :.:..|.|.|..:||.||||.....:|             |..:|..|:
Mouse   134 WING-QPSTPQLVRKCVAHVRQHDQLLPNLTVRETLAFIAQMR-------------LPRTFSQAQ 184

  Fly  1482 HMDKQ----------------------TKHYSGGNRRKLSTAISVLGNPSVLYLDEPTSGMDPAA 1524
            . ||:                      .:..|||.||::|..:.:|.||.:|.|||||||:|...
Mouse   185 R-DKRVEDVIAELRLRQCANTRVGNTYVRGVSGGERRRVSIGVQLLWNPGILILDEPTSGLDSFT 248

  Fly  1525 RRQLWQIIGLIRTAGKSIVLTSHS-MDECEALCSRLAIMVDGEFKCLGSVQSLKNQFSKGLILKV 1588
            ...|...:..:....:.::::.|. ..:...|...:.:|..|....||:.|.:...|:       
Mouse   249 AHNLVTTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQQMVQYFT------- 306

  Fly  1589 KVKHKKKTFQRVVE--DSSSSNDKKSISETDLKFLQMASVMESSQADRILKVNRFISKEIPDAEL 1651
            .:.|....:....:  ...:|.|::| .|.::..::.|..:.:...:::...:.|:.|    ||.
Mouse   307 SIGHPCPRYSNPADFYVDLTSIDRRS-KEREVATVEKAQSLAALFLEKVQGFDDFLWK----AEA 366

  Fly  1652 KEEYNGLITYYIPHSKTLSKIFQLLETNSHKLNI 1685
            ||                      |.|::|.:::
Mouse   367 KE----------------------LNTSTHTVSL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6052NP_649002.3 rim_protein 21..>54 CDD:130324
rim_protein <149..1709 CDD:130324 80/359 (22%)
Abcg8NP_080456.1 ABCG_White 71..296 CDD:213201 60/239 (25%)
3a01204 89..664 CDD:273361 74/339 (22%)
ABC2_membrane 402..606 CDD:279410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.