DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7484 and AT1G05720

DIOPT Version :9

Sequence 1:NP_649000.1 Gene:CG7484 / 39969 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_563747.1 Gene:AT1G05720 / 837079 AraportID:AT1G05720 Length:163 Species:Arabidopsis thaliana


Alignment Length:141 Identity:42/141 - (29%)
Similarity:77/141 - (54%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AIFLLLALSCQQIQAELTAADCRALGFIKAQLMCSSCEKLDDFGLD-TIKPQCKQCCTLDQQPAA 68
            |:.:|:..|....:.:|:..:|..||| ....:||.|..|.::..| .:...|.:||..|.:.:.
plant    14 AMMILILASTISAKEQLSTKECEDLGF-SGLALCSDCHSLSEYVKDQELVSDCLKCCADDSEDSM 77

  Fly    69 QR-TYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSI 132
            .: ||:.||||||..|...||:|..||:..: .|||:::::|:....|.:.:||..|:.:|::.|
plant    78 SKVTYSGAILEVCMRKLVFYPEIVGFIEEEK-EKFPSVKVQYIFNSPPKLIMLDEDGEHKESIRI 141

  Fly   133 TKWNTDTVEEF 143
            ..|..:.:.::
plant   142 DNWKREHLLQY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 23/70 (33%)
AT1G05720NP_563747.1 Sep15_SelM 84..158 CDD:285958 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I4469
eggNOG 1 0.900 - - E1_KOG3384
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3145
Inparanoid 1 1.050 78 1.000 Inparanoid score I2396
OMA 1 1.010 - - QHG55610
OrthoDB 1 1.010 - - D1405992at2759
OrthoFinder 1 1.000 - - FOG0006223
OrthoInspector 1 1.000 - - oto4270
orthoMCL 1 0.900 - - OOG6_105650
Panther 1 1.100 - - LDO PTHR13077
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.