DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7484 and selenof

DIOPT Version :9

Sequence 1:NP_649000.1 Gene:CG7484 / 39969 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_840079.1 Gene:selenof / 352923 ZFINID:ZDB-GENE-030327-1 Length:153 Species:Danio rerio


Alignment Length:149 Identity:72/149 - (48%)
Similarity:94/149 - (63%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IFLLLALSCQQ----IQAELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQP 66
            ::||..|...|    ..|||::..||.||| .:.|:|||||.|..|.|:.:...|:|||..:.|.
Zfish     5 VYLLWLLPLLQGLASYGAELSSEACRELGF-SSNLLCSSCELLGQFSLNQLDLPCRQCCQEEAQL 68

  Fly    67 AAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLS 131
            ..::.|..||||||..|...:||:|||::|.:|..|..||||||||.|||:||||.:|.:.|.||
Zfish    69 ENRKLYPGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELS 133

  Fly   132 ITKWNTDTVEEFFETHLAK 150
            |.|||||:||||....|.:
Zfish   134 ILKWNTDSVEEFLSEKLER 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 44/73 (60%)
selenofNP_840079.1 Sep15_SelM 76..151 CDD:285958 44/74 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592549
Domainoid 1 1.000 94 1.000 Domainoid score I7443
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3145
Inparanoid 1 1.050 137 1.000 Inparanoid score I4526
OMA 1 1.010 - - QHG55610
OrthoDB 1 1.010 - - D1405992at2759
OrthoFinder 1 1.000 - - FOG0006223
OrthoInspector 1 1.000 - - oto39522
orthoMCL 1 0.900 - - OOG6_105650
Panther 1 1.100 - - LDO PTHR13077
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5163
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.