DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7484 and Selenof

DIOPT Version :9

Sequence 1:NP_649000.1 Gene:CG7484 / 39969 FlyBaseID:FBgn0036745 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_579831.2 Gene:Selenof / 113922 RGDID:621291 Length:162 Species:Rattus norvegicus


Alignment Length:146 Identity:72/146 - (49%)
Similarity:94/146 - (64%) Gaps:4/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALSCQQIQ---AELTAADCRALGFIKAQLMCSSCEKLDDFGLDTIKPQCKQCCTLDQQPAAQ 69
            ||||.:.|.:.   ||.::..||.||| .:.|:||||:.|..|.|..:.|.|:.||..:.|...:
  Rat    17 LLLATAFQAVSALGAEFSSEACRELGF-SSNLLCSSCDLLGQFNLLPLDPVCRGCCQEEAQFETK 80

  Fly    70 RTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITK 134
            :.||.||||||..|...:||:|||::|.:|..|..||||||||.|||:||||.:|.:.|.|||.|
  Rat    81 KLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILK 145

  Fly   135 WNTDTVEEFFETHLAK 150
            ||||:||||....|.:
  Rat   146 WNTDSVEEFLSEKLER 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7484NP_649000.1 Sep15_SelM 74..148 CDD:285958 44/73 (60%)
SelenofNP_579831.2 Sep15_SelM 85..160 CDD:400935 44/74 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350832
Domainoid 1 1.000 94 1.000 Domainoid score I7303
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3145
Inparanoid 1 1.050 138 1.000 Inparanoid score I4440
OMA 1 1.010 - - QHG55610
OrthoDB 1 1.010 - - D1405992at2759
OrthoFinder 1 1.000 - - FOG0006223
OrthoInspector 1 1.000 - - oto97916
orthoMCL 1 0.900 - - OOG6_105650
Panther 1 1.100 - - LDO PTHR13077
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5163
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.