DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptger4

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_114465.3 Gene:Ptger4 / 84023 RGDID:628641 Length:488 Species:Rattus norvegicus


Alignment Length:437 Identity:99/437 - (22%)
Similarity:170/437 - (38%) Gaps:120/437 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFIL--ARKKLNKNSKYTLMLRCLATNNLV 77
            |::..:.|:.|   .:.:.|..::.:.||.||.:|:.:|  :||:..:.:.|||:.....|:   
  Rat     7 NASFSSTPERL---NSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTD--- 65

  Fly    78 ALLGMLTTTLLKMYLSKEVLQSFIRVDCVG--------LVVWRFFGLSSGCIAAVMAAERWMALA 134
             |||    |||   :|...:.::::....|        ..:..|||||...|...|:.||::|:.
  Rat    66 -LLG----TLL---VSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSIICAMSIERYLAIN 122

  Fly   135 RPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRYRDAPGVW----- 194
            ..:.|..::...|...::.::....|:...||.:|.|.             ..|..||.|     
  Rat   123 HAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGR-------------SERQYPGTWCFIDW 174

  Fly   195 --NKT----YAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKNSAISI 253
              |.|    ::.::..|.:.|.:..|.||:.|...||           .||...:.|        
  Rat   175 TTNVTAYAAFSYMYAGFSSFLILATVLCNVLVCGALL-----------RMHRQFMRR-------- 220

  Fly   254 DPESSSGTTLYQTQLSTGSGN----SHRSVQPARQ----YRHSVSVTMAATDSSPVEIKFAKLMA 310
               :|.||..:....:....:    .|.:..||.|    :|...|....|    ..||:...|:.
  Rat   221 ---TSLGTEQHHAAAAAAVASVACRGHAAASPALQRLSDFRRRRSFRRIA----GAEIQMVILLI 278

  Fly   311 FLSISFVICWMPQMIAIPLAIAPNRVPASNKFF---IIADV-----LTALHFTS-----DPYVYV 362
            ..|:..:||.:|.::.:.:          |:.:   ::.|:     |.|:...|     ||::|:
  Rat   279 ATSLVVLICSIPLVVRVFI----------NQLYQPSVVKDISRNPDLQAIRIASVNPILDPWIYI 333

  Fly   363 LSR----SKSI-NWSLLGCIKRWRSGWRPGGLRRSQSDQ--SRMRTT 402
            |.|    ||:| ....|.|        |.||..|..|.|  |..|.|
  Rat   334 LLRKTVLSKAIEKIKCLFC--------RIGGSGRDGSAQHCSESRRT 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 48/205 (23%)
Ptger4NP_114465.3 7tmA_PGE2_EP4 18..344 CDD:320270 84/385 (22%)
TM helix 1 20..44 CDD:320270 7/23 (30%)
TM helix 2 55..77 CDD:320270 11/32 (34%)
TM helix 3 93..115 CDD:320270 7/21 (33%)
TM helix 4 138..154 CDD:320270 1/15 (7%)
TM helix 5 181..204 CDD:320270 4/22 (18%)
TM helix 6 274..296 CDD:320270 5/21 (24%)
TM helix 7 311..336 CDD:320270 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..380 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338664
Domainoid 1 1.000 50 1.000 Domainoid score I11355
eggNOG 1 0.900 - - E33208_3BHKU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5326
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108572
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.