DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptgdr

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_071577.1 Gene:Ptgdr / 63889 RGDID:619707 Length:357 Species:Rattus norvegicus


Alignment Length:410 Identity:97/410 - (23%)
Similarity:148/410 - (36%) Gaps:140/410 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IGVIIMVLGVFGNSLALFILARKKLNK----------NSKYTLMLRCLATNNLVALLG--MLTTT 86
            :|.::...|:.||.|||.:|||..|..          :..|.|:.....|:    |||  :::..
  Rat    21 MGGVLFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVFYVLVCGLTVTH----LLGKCLISPM 81

  Fly    87 LLKMYLS----KEVLQSFIRVDCVGLV-VWRFFGLSSGCIAAVMAAERWMALARPFIYHKHITYE 146
            :|..|..    ||:|.:.....|.... :..||||:|......||.|.|::|..||.|.:|||  
  Rat    82 VLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTLQLLAMALECWLSLGHPFFYQRHIT-- 144

  Fly   147 LIRKSINSILMIAVVITF------LPFVGFGAYIDESNPDQLKCIRYRDAPGVW------NKT-- 197
                :...:|:..|...|      |||.|||           |.::|  .||.|      :|.  
  Rat   145 ----ARRGVLVAPVAGAFSLAFCALPFAGFG-----------KFVQY--CPGTWCFIQMIHKKRS 192

  Fly   198 -----YAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKNSAISIDPES 257
                 ::||:.....||.:..|.|||.....|..:..|    :|| |....|||:          
  Rat   193 FSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRR----QRH-HPRRCSRDR---------- 242

  Fly   258 SSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFAKLMAFLSISFVICWMP 322
                      ..:||...|.|..|..:..|.|                  |:|..::.|.:|.:|
  Rat   243 ----------AQSGSDYRHGSPNPLEELDHFV------------------LLALTTVLFTMCSLP 279

  Fly   323 QMI-----AIPLAIAPNRVPASNKFFIIADVLTALHFTS-----DPYVYVLSRSKSI-------- 369
            .:.     |..|.   :|....      ::.|.||.|.|     ||:::::.|:...        
  Rat   280 LIYRAYYGAFKLV---DRADGD------SEDLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKAF 335

  Fly   370 -------NWSLLGCIKRWRS 382
                   ||    |...|::
  Rat   336 TRPLIYRNW----CSHSWQT 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 61/220 (28%)
PtgdrNP_071577.1 7tm_1 58..318 CDD:278431 81/334 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11355
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5326
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.