DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and PTGER4

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_000949.1 Gene:PTGER4 / 5734 HGNCID:9596 Length:488 Species:Homo sapiens


Alignment Length:420 Identity:94/420 - (22%)
Similarity:165/420 - (39%) Gaps:103/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFIL--ARKKLNKNSKYTLMLRCLATNNLV 77
            ||:....|..|   .:.:.|..::.:.||.||.:|:.:|  :||:..:.:.|||:.....|:   
Human     7 NSSASLSPDRL---NSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTD--- 65

  Fly    78 ALLGMLTTTLLKMYLSKEVLQSFIRVDCVG--------LVVWRFFGLSSGCIAAVMAAERWMALA 134
             |||    |||   :|...:.::::....|        ..:..||.||...|...|:.||::|:.
Human    66 -LLG----TLL---VSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLAIN 122

  Fly   135 RPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRYRDAPGVW----- 194
            ..:.|..::...|...::.::....|:...||.:|.|:          ..::|   |..|     
Human   123 HAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGS----------SRLQY---PDTWCFIDW 174

  Fly   195 ------NKTYAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKNSAISI 253
                  :..|:.::..|.:.|.:..|.||:.|...||           .||...:.|        
Human   175 TTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGALL-----------RMHRQFMRR-------- 220

  Fly   254 DPESSSGTTLYQTQLSTG-SGNSHRSVQPA----RQYRHSVSVTMAATDSSPVEIKFAKLMAFLS 313
               :|.||..:....:.. :...|.:..||    ..:|...|....|    ..||:...|:...|
Human   221 ---TSLGTEQHHAAAAASVASRGHPAASPALPRLSDFRRRRSFRRIA----GAEIQMVILLIATS 278

  Fly   314 ISFVICWMPQMIAIPLAIAPNRV--PASNKFFIIADVLTALHFTS-----DPYVYVLSR----SK 367
            :..:||.:|.::.:.:    |::  |:..:.......|.|:...|     ||::|:|.|    ||
Human   279 LVVLICSIPLVVRVFV----NQLYQPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSK 339

  Fly   368 SI-NWSLLGCIKRWRSGWRPGGLRRSQSDQ 396
            :| ....|.|        |.||.||.:|.|
Human   340 AIEKIKCLFC--------RIGGSRRERSGQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 45/205 (22%)
PTGER4NP_000949.1 7tmA_PGE2_EP4 18..341 CDD:320270 80/376 (21%)
TM helix 1 19..45 CDD:320270 7/25 (28%)
TM helix 2 54..80 CDD:320270 11/36 (31%)
TM helix 3 92..122 CDD:320270 9/29 (31%)
TM helix 4 134..156 CDD:320270 4/21 (19%)
TM helix 5 180..209 CDD:320270 7/28 (25%)
TM helix 6 265..295 CDD:320270 7/33 (21%)
TM helix 7 308..333 CDD:320270 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..376 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144961
Domainoid 1 1.000 52 1.000 Domainoid score I11441
eggNOG 1 0.900 - - E33208_3BHKU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5311
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108572
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.