DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and PTGDR

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_000944.1 Gene:PTGDR / 5729 HGNCID:9591 Length:359 Species:Homo sapiens


Alignment Length:398 Identity:104/398 - (26%)
Similarity:158/398 - (39%) Gaps:125/398 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFILARKKLNKNSKYTLMLRCLATNNLVAL 79
            |:|:|       ...|..::|.::...|:.||.|||.:|||..|...|:..  ||.|.:...:.:
Human    10 NTTSV-------EKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRP--LRPLPSVFYMLV 65

  Fly    80 LGMLTTTLL-KMYLSKEVLQSF-----IRVDCVGL---------VVWRFFGLSSGCIAAVMAAER 129
            .|:..|.|| |..||..||.::     :||....|         ....||||||......||.|.
Human    66 CGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLAMALEC 130

  Fly   130 WMALARPFIYHKHITYELIRKSINSILMIAVVITF------LPFVGFGAYIDESNPDQLKCIRYR 188
            |::|..||.|.:|||..|      ..|:..||..|      |||:|||           |.::| 
Human   131 WLSLGHPFFYRRHITLRL------GALVAPVVSAFSLAFCALPFMGFG-----------KFVQY- 177

  Fly   189 DAPGVW--------NKTYAVL--FMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLV 243
             .||.|        ..:.:||  .:::.:|:.::::|       |:||.:|..|           
Human   178 -CPGTWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLA-------TVLCNLGAMR----------- 223

  Fly   244 SRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAAT-------DSSP- 300
                              .||.         .||.:|     ||..|.|....       ::|| 
Human   224 ------------------NLYA---------MHRRLQ-----RHPRSCTRDCAEPRADGREASPQ 256

  Fly   301 --VEIKFAKLMAFLSISFVICWMPQMIAIPLAIAPNRVPASNKFFIIADVLTALHFTS-----DP 358
              .|:....|:|.:::.|.:|.:| :|......|...|...|:....|:.|.||.|.|     ||
Human   257 PLEELDHLLLLALMTVLFTMCSLP-VIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDP 320

  Fly   359 YVYVLSRS 366
            :::::.||
Human   321 WIFIIFRS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 63/215 (29%)
PTGDRNP_000944.1 7tmA_PGD2 17..335 CDD:320268 101/384 (26%)
TM helix 1 18..44 CDD:320268 10/25 (40%)
TM helix 2 61..87 CDD:320268 9/25 (36%)
TM helix 3 105..135 CDD:320268 10/29 (34%)
TM helix 4 147..169 CDD:320268 7/27 (26%)
TM helix 5 195..224 CDD:320268 9/64 (14%)
TM helix 6 258..288 CDD:320268 7/30 (23%)
TM helix 7 302..327 CDD:320268 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11441
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5311
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10330
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.100

Return to query results.
Submit another query.