DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and ptgfr

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001172000.1 Gene:ptgfr / 571808 ZFINID:ZDB-GENE-120919-6 Length:390 Species:Danio rerio


Alignment Length:341 Identity:76/341 - (22%)
Similarity:133/341 - (39%) Gaps:74/341 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IIMVLGVFGNSLALFIL--ARKKLNKNSKYTLMLRCLATNNLVA-LLGMLT--TTLLKMYLSKEV 96
            |.|.:|:..|:||||||  |..:....||...:|  .|:..::. .||.|.  :..|.:|:|::.
Zfish    32 ISMTVGIVSNTLALFILIKAYHRFRYKSKAAFLL--FASGLVITDFLGHLINGSLALYVYVSQKE 94

  Fly    97 LQSFIR----VDCVGLVVWRFFGLSSGCIAAVMAAERWMALARPFIYHKHITYELIRKSINSILM 157
            .::|..    .|..| |...||||:...:..:||.||.:.:.||..:...:....:::.:....:
Zfish    95 WETFDNHKSLCDFFG-VCMAFFGLTPLLLGCLMAVERCIGVTRPLFHTTALGSHHVKRLLGVTWL 158

  Fly   158 IAVVITFLPFVGFGAYIDESNPDQLKCIRYRDAPGVWNKT-YAVLFMVFGTLLCIVIVACNLFVA 221
            :.:::..||.:...:|  :....:..|......|..|..| ..:||...|.|..:|.:.||....
Zfish   159 LGLLVALLPVLFQRSY--QVQRSRSWCFFRLQGPRDWMDTLLPILFSALGLLALLVSLLCNTMTF 221

  Fly   222 HTLLCVIGRSRTAKRHMHYDLVSRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYR 286
            .|||    |||          |..|:                          |:||..:.|..:.
Zfish   222 LTLL----RSR----------VQLDR--------------------------NNHRHSRKASHHS 246

  Fly   287 HSVSVTMAATDSSPVEIKFAKLMAFLSISFVICWMPQMIAIPLAIAPNRVPASNKF--FIIADVL 349
            ..|                .:|:|.:.:| .:||.|.:|...:....:|......:  .::...:
Zfish   247 EMV----------------CQLLAIMLVS-CVCWGPILITAIIFSLQDRGEDQTSYTHMLLVVRM 294

  Fly   350 TALHFTSDPYVYVLSR 365
            ...:...||:||:|.|
Zfish   295 ATWNQILDPWVYILLR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 49/193 (25%)
ptgfrNP_001172000.1 7tm_1 41..306 CDD:278431 69/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.