DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and ptger2b

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001025421.1 Gene:ptger2b / 570410 ZFINID:ZDB-GENE-040724-267 Length:341 Species:Danio rerio


Alignment Length:363 Identity:76/363 - (20%)
Similarity:134/363 - (36%) Gaps:132/363 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GVFGNSLALFIL-ARKKLNKNSKYTLMLRCLATNNLVALLGMLTTTLLKMYLSKEVLQSFIR-VD 104
            ||.||.:||.:| .|::....|.:.:::..|.   :..|||..:       ||..||.::.| ..
Zfish    29 GVLGNVVALILLEMRRRKQPASLFHVLVSSLV---ITDLLGTFS-------LSPLVLTAYFRNAS 83

  Fly   105 CVGL-----------VVWRFFGLSSGCIAAVMAAERWMALARPFIYHKHITYELIRKSINSILMI 158
            .:|:           ....||.:.:..|...||.|||:::..||.|.|:.:......:|..|.::
Zfish    84 LLGMNENRLACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLL 148

  Fly   159 AVVITFLPFVGFGAYIDESNPDQLKCIRYRDAPGVW-----------NKTYAVLFMVFGTLLCIV 212
            ..:....||:|||.|           ::|  .||.|           :|.:.:::.....|:.:.
Zfish   149 CALFCVTPFLGFGKY-----------VQY--CPGTWCFIDMDPSASEHKAFNIIYASCLLLMIVC 200

  Fly   213 IVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHR 277
            .|.||..|.:.:      ||..:|.                                    .:||
Zfish   201 TVLCNASVIYHI------SRMYRRL------------------------------------KAHR 223

  Fly   278 -SVQPARQYRHSVSVTMAATDSSPVEIKFAKLMAFLSISFVICWMPQMI---------------- 325
             ||:..|.::...|:|.        |::...|:.|::|:||.|.:|.:|                
Zfish   224 SSVRRQRGHKRHRSMTK--------EVEHLVLLWFMTIAFVFCSLPLVIQVYHNTLYHRDRHRNN 280

  Fly   326 AIPLAIAPNRVPASNKFFIIADVLTALHFTSDPYVYVL 363
            .|||            .|:.|:.:.      ||:|:::
Zfish   281 VIPL------------LFLSANPII------DPWVFII 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 48/202 (24%)
ptger2bNP_001025421.1 7tm_4 26..>238 CDD:304433 57/273 (21%)
7tm_1 32..297 CDD:278431 73/355 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10806
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5323
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10330
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.100

Return to query results.
Submit another query.