DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and ptger2a

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_956929.1 Gene:ptger2a / 393608 ZFINID:ZDB-GENE-040426-1321 Length:281 Species:Danio rerio


Alignment Length:339 Identity:73/339 - (21%)
Similarity:126/339 - (37%) Gaps:109/339 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IGVIIMVLGVFGNSLALFILA-RKKLNKN----SKYTLMLRCLA---------TNNLVALLGMLT 84
            |..::...|..||.|||.:|. |::..||    |.:.|::..|.         |:.:|....:..
Zfish    22 ISALMFAAGAIGNVLALVLLEFRRRKEKNRQRQSLFHLLVTTLVITDLTGTCLTSPVVQTAYLTN 86

  Fly    85 TTLLKMYLSKEVLQSFIRVDCVGLVVWRFFGLSSGCIAAVMAAERWMALARPFIYHKHITYELIR 149
            |||:.|..:..|.:.|      |..: .|..|::..|...||.||.:::..|:.|.:|||.....
Zfish    87 TTLVGMSKTHAVCEYF------GFAM-TFLSLATLSILLAMALERCISIGYPYHYGRHITKRCGY 144

  Fly   150 KSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRYRDAPGVW-----------NKTYAVLFM 203
            .:|..|.:...:...:||.|||.|           ::|  .||.|           ::.||.::.
Zfish   145 ITIPCIYLACFLFCLMPFAGFGKY-----------VQY--CPGTWCFIAMNSEEIEDRAYANVYA 196

  Fly   204 VFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKNSAISIDPESSSGTTLYQTQL 268
            .....:.|:||.||.||.:.|:.:..|.:                              :.:..:
Zfish   197 TVMLFIMIIIVVCNCFVVYHLVLMYRRRK------------------------------MNRGSV 231

  Fly   269 STGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFAKLMAFLSISFVICWMPQMIAIPLAIAP 333
            .|.|..:.|....|.:..|.:                  |:.|:::.||||::|.::.       
Zfish   232 QTRSKRNRRYFSWAEEVEHLI------------------LLVFMTVIFVICFLPLIVR------- 271

  Fly   334 NRVPASNKFFIIAD 347
                     ||:.|
Zfish   272 ---------FIVCD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 54/209 (26%)
ptger2aNP_956929.1 7tm_4 <101..>242 CDD:304433 40/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10806
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5323
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 1 1.000 - - oto40824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10330
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.