DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptgir

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001071112.1 Gene:Ptgir / 292661 RGDID:1310890 Length:416 Species:Rattus norvegicus


Alignment Length:433 Identity:98/433 - (22%)
Similarity:153/433 - (35%) Gaps:139/433 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TPVLDLLMPHNSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFILARKKLNKNSKYTLMLR 69
            |.|.|.:.|..||                   ::.|.||.||.|||.||..::.:..|.:.:::.
  Rat    38 TYVQDSVGPATST-------------------LMFVAGVVGNGLALGILGARRRSHPSAFAVLVT 83

  Fly    70 CLATNNLVALLGMLTTTLLKMYLSKEVLQSFIR-VDCVGLV------------VWRFFGLSSGCI 121
            .||..:|:.          ..:||..|..::.| ...:||.            ...||||:|..|
  Rat    84 GLAVTDLLG----------TCFLSPAVFVAYARNSSLLGLAHGGTMLCDTFAFAMTFFGLASTLI 138

  Fly   122 AAVMAAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIR 186
            ...||.||.:||:.|::|.:.......|.::.:|.....:...||.:|.|.: .:..|.....||
  Rat   139 LFAMAVERCLALSHPYLYAQLDGPRCARLALPAIYAFCCLFCSLPLLGLGEH-QQYCPGSWCFIR 202

  Fly   187 YRD-APG--VWNKTYAVLFMVFGTLLCIVIVACNLFVAHTL-LCVIGRSRTAKRHMHYDLVSRDK 247
            .|. .||  .::..||.|.    .||...|..||..|  || ||.:.|.:  :||          
  Rat   203 MRSPQPGGCAFSLAYASLM----ALLVTSIFFCNGSV--TLSLCHMYRQQ--RRH---------- 249

  Fly   248 NSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFAKLMAFL 312
                                        |.|..|..:.|..             |:....|:|.:
  Rat   250 ----------------------------HGSFVPTSRARED-------------EVYHLILLALM 273

  Fly   313 SISFVICWMPQMI-AIPLAIAPNRVPASNKFFIIADVLTALHFTS-----DPYVYVLSR------ 365
            :....:|.:|..| ....||||:.....:        |.|..|.:     ||:|::|.|      
  Rat   274 TGIMAVCSLPLTIRGFTQAIAPDSREMGD--------LHAFRFNAFNPILDPWVFILFRKAVFQR 330

  Fly   366 ---------SKSINWSLLGCIKRWRSGWR----PGGLRRSQSD 395
                     ::|::..|...:.|..||.|    |..|:..:.:
  Rat   331 LKFWLCCLCARSVHGDLQTPLSRPVSGRRDTLAPDSLQAKEGN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 54/200 (27%)
PtgirNP_001071112.1 7tm_4 56..>247 CDD:304433 59/209 (28%)
7tm_1 59..319 CDD:278431 78/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11355
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5326
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 1 1.000 - - oto98905
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11866
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.