DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptgfr

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_037247.1 Gene:Ptgfr / 25652 RGDID:3436 Length:366 Species:Rattus norvegicus


Alignment Length:352 Identity:80/352 - (22%)
Similarity:140/352 - (39%) Gaps:83/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRNRLIIGVIIMVLGVFGNSLALFIL--ARKKLNKNSKYTLMLRCLATNNLVA-LLGMLTT--TL 87
            ||..:...:|.|.:|:..||||:.||  |.::..:.||.:.:|  ||:..::. ..|.|..  ..
  Rat    26 NRLSVFFSIIFMTVGIVSNSLAIAILMKAYQRFRRKSKASFLL--LASGLVITDFFGHLINGGIA 88

  Fly    88 LKMYLSKEVLQSFIRVDCVGLVVWRFFGLS---SG-C---IAAVMAAERWMALARPFIYHKHITY 145
            :.:|.|.   :.:||.| ...::...||:|   || |   :.:.||.||.:.:..|..:...||.
  Rat    89 VFVYASD---KDWIRFD-QSNILCSVFGISMVFSGLCPLFLGSTMAIERCIGVTNPLFHSTKITS 149

  Fly   146 ELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRYRDAPGVW-NKTYAVLFMVFGTLL 209
            :.::..::.:.|.||.:..||.:|...|  :....:..|....:....| ::.|.:.|...|.|.
  Rat   150 KHVKMILSGVCMFAVFVALLPILGHRDY--QIQASRTWCFYNTEHIEDWEDRFYLLFFSSLGLLA 212

  Fly   210 CIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKNSAISIDPESSSGTTLYQTQLSTGSGN 274
            ..:..:||.....|||.|..||:..::                                    |.
  Rat   213 LGISFSCNAVTGVTLLRVKFRSQQHRQ------------------------------------GR 241

  Fly   275 SHRSVQPARQYRHSVSVTMAATDSSPVEIKFAKLMAFLSISFVICWMPQMIAIP-LAIAPNRVPA 338
            ||          |...|              .:|:|.:.:| .:||.|.::.:. :||..|..|.
  Rat   242 SH----------HLEMV--------------IQLLAIMCVS-CVCWSPFLVTMANIAINGNNSPV 281

  Fly   339 SNKFFIIADVLTALHFTSDPYVYVLSR 365
            :.:..:.|..:...:...||:||:|.|
  Rat   282 TCETTLFALRMATWNQILDPWVYILLR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 50/197 (25%)
PtgfrNP_037247.1 7tmA_FP 27..316 CDD:320273 79/351 (23%)
TM helix 1 29..53 CDD:320273 9/23 (39%)
TM helix 2 67..89 CDD:320273 5/23 (22%)
TM helix 3 109..131 CDD:320273 7/21 (33%)
TM helix 4 154..170 CDD:320273 3/15 (20%)
TM helix 5 198..221 CDD:320273 5/22 (23%)
TM helix 6 248..270 CDD:320273 7/36 (19%)
TM helix 7 283..308 CDD:320273 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.