DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptger3

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_038957686.1 Gene:Ptger3 / 24929 RGDID:3435 Length:417 Species:Rattus norvegicus


Alignment Length:395 Identity:94/395 - (23%)
Similarity:149/395 - (37%) Gaps:122/395 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 APPKALYANRNR-----------LIIGVIIMVLGVFGNSLALFILARKKLNKNSK-YTLMLRCLA 72
            ||..::.|:.|:           :...:.:||.|..||:||:.:::|....:.|| ....|.|:.
  Rat     6 APEHSVEAHSNQSSAADGCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESKRKKSFLLCIG 70

  Fly    73 TNNLVALLGMLTTT--LLKMYLSK---EVLQSFIRVDCV--GLVVWRFFGLSSGCIAAVMAAERW 130
            ...|..|:|.|.|:  ::.:|||:   |.|....|: |.  ||.: ..|||||..:|:.||.||.
  Rat    71 WLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRL-CTFFGLTM-TVFGLSSLLVASAMAVERA 133

  Fly   131 MALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRYRDAPGVW- 194
            :|:..|..|..|:.....|..:..:.:..:....||.:|.|.|          .:::   ||.| 
  Rat   134 LAIRAPHWYASHMKTRATRAVLLGVWLSVLAFALLPVLGVGRY----------SVQW---PGTWC 185

  Fly   195 --------NKT----------YAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYD 241
                    |:|          :|..|...|.|..:|..||||             .|.|.     
  Rat   186 FISTGPAGNETDSAREPGSVAFASAFACLGLLALVVTFACNL-------------ATIKA----- 232

  Fly   242 LVSRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFA 306
            ||||.:..|.:....:..|....:|                                   .|:..
  Rat   233 LVSRCRAKAAASQSSAQWGRITTET-----------------------------------AIQLM 262

  Fly   307 KLMAFLSISFVICWMPQMIAIPLAIAPNRVPASN-----------KFFIIADVLTALHFTSDPYV 360
            .:|..||    :||.|.:|.: |.:..|::....           ..|:||..|.:|:...||:|
  Rat   263 GIMCVLS----VCWSPLLIMM-LKMIFNQMSVEQCKTQMGKEKECNSFLIAVRLASLNQILDPWV 322

  Fly   361 YVLSR 365
            |:|.|
  Rat   323 YLLLR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 60/211 (28%)
Ptger3XP_038957686.1 TM helix 5 203..232 CDD:410628 10/41 (24%)
TM helix 6 252..282 CDD:410628 10/69 (14%)
TM helix 7 302..327 CDD:410628 10/24 (42%)
7tm_GPCRs 26..335 CDD:421689 90/375 (24%)
TM helix 1 27..53 CDD:410628 7/25 (28%)
TM helix 2 65..91 CDD:410628 7/25 (28%)
TM helix 3 107..137 CDD:410628 14/30 (47%)
TM helix 4 149..171 CDD:410628 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338666
Domainoid 1 1.000 50 1.000 Domainoid score I11355
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5326
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.960

Return to query results.
Submit another query.