DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptgir

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_032993.2 Gene:Ptgir / 19222 MGIID:99535 Length:415 Species:Mus musculus


Alignment Length:413 Identity:94/413 - (22%)
Similarity:147/413 - (35%) Gaps:123/413 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TPVLDLLMPHNSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFILARKKLNKNSKYTLMLR 69
            |.|.|.:.|..||                   ::.|.||.||.|||.||..::.:..|.:.:::.
Mouse    37 TYVQDSVGPATST-------------------LMFVAGVVGNGLALGILGARRRSHPSAFAVLVT 82

  Fly    70 CLATNNLVALLGMLTTTLLKMYLSKEVLQSFIR-VDCVGLV------------VWRFFGLSSGCI 121
            .||..:|:.          ..:||..|..::.| ...:||.            ...||||:|..|
Mouse    83 GLAVTDLLG----------TCFLSPAVFVAYARNSSLLGLAHGGTMLCDTFAFAMTFFGLASTLI 137

  Fly   122 AAVMAAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIR 186
            ...||.||.:||:.|::|.:.......|.::.||.....:...||.:|.|.: .:..|.....||
Mouse   138 LFAMAVERCLALSHPYLYAQLDGPRCARFALPSIYAFCCLFCSLPLLGLGEH-QQYCPGSWCFIR 201

  Fly   187 YRDA-PG--VWNKTYAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYDLVSRDKN 248
            .|.| ||  .::..||.|.    .||...|..||   ....|.:....|..:||           
Mouse   202 MRSAQPGGCAFSLAYASLM----ALLVTSIFFCN---GSVTLSLYHMYRQQRRH----------- 248

  Fly   249 SAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFAKLMAFLS 313
                                       |.|..|..:.|..             |:....|:|.::
Mouse   249 ---------------------------HGSFVPTSRARED-------------EVYHLILLALMT 273

  Fly   314 ISFVICWMPQMI-AIPLAIAPNRVPASNKFFIIADVLTALHFTSDPYVYVLSR------------ 365
            :...:|.:|.|| ....||||:.....:   ::|....|.:...||:|::|.|            
Mouse   274 VIMAVCSLPLMIRGFTQAIAPDSREMGD---LLAFRFNAFNPILDPWVFILFRKAVFQRLKFWLC 335

  Fly   366 ---SKSINWSLLGCIKRWRSGWR 385
               ::|::..|...:.|..||.|
Mouse   336 CLCARSVHGDLQAPLSRPASGRR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 56/200 (28%)
PtgirNP_032993.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
7tm_4 55..>246 CDD:304433 57/208 (27%)
7tm_1 58..318 CDD:278431 76/331 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..370 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11155
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5355
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 1 1.000 - - oto95418
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11866
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.