DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptger4

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_032991.1 Gene:Ptger4 / 19219 MGIID:104311 Length:513 Species:Mus musculus


Alignment Length:446 Identity:104/446 - (23%)
Similarity:176/446 - (39%) Gaps:117/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTPVLDLLMPH-NSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFIL--ARKKLNKNSKYT 65
            ||.::.:  |. |::..:.|:.|   .:.:.|..::.:.||.||.:|:.:|  :||:..:.:.||
Mouse    22 TTTIMSI--PGVNASFSSTPERL---NSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYT 81

  Fly    66 LMLRCLATNNLVALLGMLTTTLLKMYLSKEVLQSFIRVDCVG--------LVVWRFFGLSSGCIA 122
            |:.....|:    |||    |||   :|...:.::::....|        ..:..|||||...|.
Mouse    82 LVCGLAVTD----LLG----TLL---VSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSII 135

  Fly   123 AVMAAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNPDQLKCIRY 187
            ..|:.||::|:...:.|..::...|...::.:|....|:...||.:|.|.             ..
Mouse   136 CAMSIERYLAINHAYFYSHYVDKRLAGLTLFAIYASNVLFCALPNMGLGR-------------SE 187

  Fly   188 RDAPGVW-------NKT----YAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHYD 241
            |..||.|       |.|    ::.::..|.:.|.:..|.||:.|...||           .||..
Mouse   188 RQYPGTWCFIDWTTNVTAYAAFSYMYAGFSSFLILATVLCNVLVCGALL-----------RMHRQ 241

  Fly   242 LVSRDKNSAISIDPESSSGTTLYQTQLSTGSGN----SHRSVQPARQ----YRHSVSVTMAATDS 298
            .:.|           :|.||..:....:....:    .|....||.|    :|...|....|   
Mouse   242 FMRR-----------TSLGTEQHHAAAAAAVASVACRGHAGASPALQRLSDFRRRRSFRRIA--- 292

  Fly   299 SPVEIKFAKLMAFLSISFVICWMPQMIAIPLAIAPNRVPASNKFFIIADV-----LTALHFTS-- 356
             ..||:...|:...|:..:||.:|.::.:.:    |::...|   ::.|:     |.|:...|  
Mouse   293 -GAEIQMVILLIATSLVVLICSIPLVVRVFI----NQLYQPN---VVKDISRNPDLQAIRIASVN 349

  Fly   357 ---DPYVYVLSR----SKSI-NWSLLGCIKRWRSGWRPGGLRRSQSDQ--SRMRTT 402
               ||::|:|.|    ||:| ....|.|        |.||..|..|.|  |..|.|
Mouse   350 PILDPWIYILLRKTVLSKAIEKIKCLFC--------RIGGSGRDSSAQHCSESRRT 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 49/205 (24%)
Ptger4NP_032991.1 7tm_4 54..>254 CDD:304433 58/245 (24%)
7tm_1 59..357 CDD:278431 78/354 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..403 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835066
Domainoid 1 1.000 54 1.000 Domainoid score I11155
eggNOG 1 0.900 - - E33208_3BHKU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5355
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108572
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.