DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and Ptgdr

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_032988.3 Gene:Ptgdr / 19214 MGIID:102966 Length:357 Species:Mus musculus


Alignment Length:432 Identity:101/432 - (23%)
Similarity:157/432 - (36%) Gaps:157/432 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IGVIIMVLGVFGNSLALFILARKKLNK----------NSKYTLMLRCLATNNLVALLG--MLTTT 86
            :|.::...|:.||.|||.:|||..|..          :..|.|:.....|:    |||  :::..
Mouse    21 MGAVLFGAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVFYVLVCGLTVTD----LLGKCLISPM 81

  Fly    87 LLKMYLSKEVLQSFIRVD----CVGLV-VWRFFGLSSGCIAAVMAAERWMALARPFIYHKHITYE 146
            :|..|...:.|:..:...    |.... :..||||:|......||.|.|::|..||.|.:|:|  
Mouse    82 VLAAYAQNQSLKELLPASGNQLCETFAFLMSFFGLASTLQLLAMAVECWLSLGHPFFYQRHVT-- 144

  Fly   147 LIRKSINSILMIAVVITF------LPFVGFGAYIDESNPDQLKCIRYRDAPGVW------NKT-- 197
             :|:   .:|:..||..|      |||.|||           |.::|  .||.|      :|.  
Mouse   145 -LRR---GVLVAPVVAAFCLAFCALPFAGFG-----------KFVQY--CPGTWCFIQMIHKERS 192

  Fly   198 -----YAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHMHY-DLVSRDKNSAISIDPE 256
                 ::||:.....||.:..|.|||...:.|..:..|.|      || ...|||:         
Mouse   193 FSVIGFSVLYSSLMALLVLATVVCNLGAMYNLYDMHRRQR------HYPHRCSRDR--------- 242

  Fly   257 SSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFAKLMAFLSISFVICWM 321
                       ..:||...|.|:.|..:..|.|                  |:|.:::.|.:|.:
Mouse   243 -----------AQSGSDYRHGSLHPLEELDHFV------------------LLALMTVLFTMCSL 278

  Fly   322 PQMI-----AIPLAIAPNRVPASNKFFIIADVLTALHFTS-----DPYVYVLSRSKSI------- 369
            |.:.     |..|         .||....::.|.||.|.|     ||:::::.|:...       
Mouse   279 PLIYRAYYGAFKL---------ENKAEGDSEDLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKV 334

  Fly   370 --------NWSLLGCIKRWRSGWRPGGLRRSQSDQSRMRTTM 403
                    |||                   |.|.||.:.:|:
Mouse   335 FTRPLIYRNWS-------------------SHSQQSNVESTL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 60/220 (27%)
PtgdrNP_032988.3 7tm_1 58..318 CDD:278431 81/335 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11155
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5355
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11866
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10330
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.100

Return to query results.
Submit another query.