DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and srx-28

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_503749.3 Gene:srx-28 / 187606 WormBaseID:WBGene00005919 Length:301 Species:Caenorhabditis elegans


Alignment Length:237 Identity:46/237 - (19%)
Similarity:88/237 - (37%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IIGVIIMVLGVFGNSLALFILARKKLNKNSKYTLMLRCLATNNLVALLGMLTTTLLKMYLSKEVL 97
            :|..||...|:|.| |::.....|..:.:..:.::.:.....|:: :..:....:|.:.||.  |
 Worm     9 VIAFIITFSGIFIN-LSVIYAINKTPSMSGSFGIITKSQVVCNMI-MCSIYILFVLPLQLSS--L 69

  Fly    98 QSFIRVDCVGLVVWRFFGLSSGCIAAVM-------AAERWMALARPFIYHKHI---TYELIRKSI 152
            ..||.:.       .:||.::..:..:.       |..|..||..| :::.||   :..:..::.
 Worm    70 SHFIPIS-------HYFGTAAQTVYIISNLSHFLNALNRCCALFMP-LWYTHIFSNSKTVFYRNF 126

  Fly   153 NSILMIAVVITFLPFVGFGAYIDESNPDQLKC-IRYRDAPGVWNKTYA--------VLFMVFGTL 208
            ..|..|...||...|              .|| :.|  ||..|:..:.        ..::.|...
 Worm   127 IWIFSIIFCITLYEF--------------FKCFLLY--APKSWSFQFVQNPVCNQITWYLDFNFN 175

  Fly   209 LCIVIVACNLFVAHTLLCVIGR--SRTAKRHMHYDLVSRDKN 248
            ..|:|:.   .:...|:..:||  |:|......|..|.|.::
 Worm   176 CSIIIIT---LIIDLLVAFVGRKHSKTLPVGSEYSKVLRKRD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 37/203 (18%)
srx-28NP_503749.3 TM helix 1 9..32 CDD:341315 7/23 (30%)
7TM_GPCR_Srx 12..272 CDD:370981 45/234 (19%)
TM helix 2 39..65 CDD:341315 2/26 (8%)
TM helix 3 77..106 CDD:341315 5/28 (18%)
TM helix 4 119..136 CDD:341315 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.