DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and ADRA1B

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:XP_011532737.1 Gene:ADRA1B / 147 HGNCID:278 Length:556 Species:Homo sapiens


Alignment Length:469 Identity:94/469 - (20%)
Similarity:168/469 - (35%) Gaps:142/469 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTTPVLDLLMPHNSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFILA-RKKLNKNSKYTL 66
            :|.|.||:           .:|:...   |::|..|: ..:.||.|.:..:| .:.|...:.|.:
Human    35 STLPQLDI-----------TRAISVG---LVLGAFIL-FAIVGNILVILSVACNRHLRTPTNYFI 84

  Fly    67 MLRCLATNNLVALLGMLTTTLLKMYLSKEVLQSFI--RVDCVGLVVWRFFGLSSGCIAAVM---- 125
            :       ||.....:|:.|:|....:.|||..::  |:.|   .:|....:.. |.|:::    
Human    85 V-------NLAMADLLLSFTVLPFSAALEVLGYWVLGRIFC---DIWAAVDVLC-CTASILSLCA 138

  Fly   126 -AAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFGAYIDESNP-DQLKCIRYR 188
             :.:|::.:.....|...:|......::.|:.:::.||:..|.:|:    .|..| |..:|    
Human   139 ISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGW----KEPAPNDDKEC---- 195

  Fly   189 DAPGVWNKTYAVLFMVFGT----LLCIVIVACNLFVAHTLLCVIGRSRTAK-------RHMHYDL 242
               ||..:.:..||...|:    |..|:::.|.:::.        ..||.|       :.|    
Human   196 ---GVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIV--------AKRTTKNLEAGVMKEM---- 245

  Fly   243 VSRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEIKFAK 307
             |..|...:.|..::....||..|:   ..|::.||....:.::.|            .|.|.||
Human   246 -SNSKELTLRIHSKNFHEDTLSSTK---AKGHNPRSSIAVKLFKFS------------REKKAAK 294

  Fly   308 LMAFLSISFVICWMPQMIAIPL--------------------------AIAPNRVPASNKFF--- 343
            .:..:...|::||:|..||:||                          .:.|.....|...|   
Human   295 TLGIVVGMFILCWLPFFIALPLDPDSPPPTHLRVVPAPWGHSSIMNLPLVLPLDATRSGSLFSTL 359

  Fly   344 -----IIADVLTALHFTS--DPYVYVLS---------------------RSKSINWSLLGCIKRW 380
                 :...|....:|.|  :|.:|..|                     |.:.....|.||...:
Human   360 KPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTY 424

  Fly   381 RSGWRPGGLRRSQS 394
            |...|.|.|.||||
Human   425 RPWTRGGSLERSQS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 40/197 (20%)
ADRA1BXP_011532737.1 7tm_4 57..>181 CDD:304433 25/135 (19%)
7tm_1 62..384 CDD:278431 72/371 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.