DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and tbxa2r

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001272464.1 Gene:tbxa2r / 102216340 ZFINID:ZDB-GENE-131016-6 Length:371 Species:Danio rerio


Alignment Length:406 Identity:84/406 - (20%)
Similarity:139/406 - (34%) Gaps:140/406 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTTPVLDLLMPHNSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFILAR----KKLNKNSK 63
            |.||.    ..||.|..:           .....:...||:..|..||.:||:    .|....|.
Zfish    13 TNTPP----FKHNHTIAS-----------AYFSAVFSGLGLSSNLFALLVLAKTFHHTKSRSRSS 62

  Fly    64 YTLMLRCLATNNLVALL--GMLTTTLLKMYLSKEVLQ------SFIRVDCVGLVVWRFFGLSSGC 120
            :.|.|..|...:.:.||  |.:..:....:.:...|.      :|:.:..|      |:||....
Zfish    63 FLLFLGGLVFTDFMGLLVTGSIVVSYHITHFNWRQLDPQCHFCNFMGMSMV------FYGLCPLL 121

  Fly   121 IAAVMAAERWMALARPFIYHKHITYELIRKSINSILM---IAVV------ITFLPFVGFGAYIDE 176
            :.|.||.||::.:.|||          .|.|:::..:   :|:|      |:.||.||.|.|   
Zfish   122 LGAAMAVERFVGINRPF----------ARSSMSNTRVCWTVALVWVTAGSISLLPLVGLGHY--- 173

  Fly   177 SNPDQLKCIRYRDAPGVW---NKTYAVLFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHM 238
                      :...||.|   |.:.|.|.:.||.:..:|.:|                       
Zfish   174 ----------HLQVPGSWCFLNISSAPLDITFGLIFSLVGLA----------------------- 205

  Fly   239 HYDLVSRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEI 303
                     :.|:|....:.|..||  .::..|:.    |.|..|.|                |:
Zfish   206 ---------SLAVSFLLNTVSVVTL--LRVCCGAD----STQRRRDY----------------EV 239

  Fly   304 KFAKLMAFLSISFVICWMPQMIAIPLAIAPNRVPASNKFFIIADVLTALHFTS-----DPYVYVL 363
            :....:..:.:...|||.|.::.|...:      .|.....:..:|..|.|.:     ||:||:|
Zfish   240 EMMVQLILIMVIASICWCPLLVFIAQTV------LSGSELDVRYLLLWLRFATGNQVLDPWVYIL 298

  Fly   364 SR-------SKSINWS 372
            .|       :..::||
Zfish   299 FRRAILKRVAPKMDWS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 50/208 (24%)
tbxa2rNP_001272464.1 7tm_1 41..296 CDD:278431 70/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.