DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7497 and ptger4

DIOPT Version :9

Sequence 1:NP_001287100.1 Gene:CG7497 / 39966 FlyBaseID:FBgn0036742 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001120554.1 Gene:ptger4 / 100145708 XenbaseID:XB-GENE-992300 Length:471 Species:Xenopus tropicalis


Alignment Length:412 Identity:97/412 - (23%)
Similarity:165/412 - (40%) Gaps:133/412 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TPVLDLLMPHNSTTVAPPKALYANRNRLIIGVIIMVLGVFGNSLALFIL--ARKKLNKNSKYTLM 67
            |.:.:|:.|..||   ||          ||..::.:|||.||.:|:.:|  :||:..:.:.|||:
 Frog    13 TSIQNLVAPRGST---PP----------IIPAVMFLLGVVGNLIAIIVLCKSRKEQKETTFYTLV 64

  Fly    68 LRCLATNNLVALLGMLTTTLLKMYLSKEVLQSFIRVD-------C-VGLVVWRFFGLSSGCIAAV 124
            ..       :||..:|.|.|    :|...:.::|:.:       | .|..:..||||:...|...
 Frog    65 CG-------LALTDLLGTCL----ISPVTIATYIQGEWPGGHALCEYGSFILLFFGLAGLSIICA 118

  Fly   125 MAAERWMALARPFIYHKHITYELIRKSINSILMIAVVITFLPFVGFG----------AYIDESNP 179
            |:.||::|:...:.|:.::..:|...::.:|.:..|:...||.:|.|          .:||    
 Frog   119 MSIERYLAINHAYFYNHYVDKKLAGLTLFAIYVSNVLFCALPSMGLGKTTFQYPKTWCFID---- 179

  Fly   180 DQLKCIRYRDAPGVWN---KTYAV---LFMVFGTLLCIVIVACNLFVAHTLLCVIGRSRTAKRHM 238
                          |.   .|||.   ::..|.:.|.:..|.||:     |:||      |...|
 Frog   180 --------------WRTNVSTYAAYSYMYAGFSSFLILATVLCNV-----LVCV------ALIRM 219

  Fly   239 HYDLVSRDKNSAISIDPESSSGTTLYQTQLSTGSGNSHRSVQPARQYRHSVSVTMAATDSSPVEI 303
            |...|.|                      .|.|:.|.....:..|.:|.     ||.     .||
 Frog   220 HRQFVRR----------------------TSLGTDNRLSDFRRRRSFRR-----MAG-----AEI 252

  Fly   304 KFAKLMAFLSISFVICWMPQMIAIPLAIAPNRV--PASNKFFIIADV-----LTALHFTS----- 356
            :...::...|:..|||..|.::.|.:    |::  ||     ::.|:     |.|:...|     
 Frog   253 QMVIVLIGTSVVVVICSTPLVVRIFI----NQLYQPA-----VVEDISKNPDLQAIRMASVNPIL 308

  Fly   357 DPYVYVLSRSKSINWSLLGCIK 378
            ||::|:|.| |::...|:..||
 Frog   309 DPWIYILLR-KTVLSKLIEKIK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7497NP_001287100.1 7tm_4 36..>221 CDD:304433 49/210 (23%)
ptger4NP_001120554.1 7tm_4 35..>222 CDD:304433 55/226 (24%)
7tm_1 40..313 CDD:278431 78/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11154
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5184
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412827at33208
OrthoFinder 1 1.000 - - FOG0000857
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.