DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anchor and EIR1

DIOPT Version :9

Sequence 1:NP_001261995.1 Gene:anchor / 39965 FlyBaseID:FBgn0036741 Length:957 Species:Drosophila melanogaster
Sequence 2:NP_568848.1 Gene:EIR1 / 835813 AraportID:AT5G57090 Length:647 Species:Arabidopsis thaliana


Alignment Length:174 Identity:40/174 - (22%)
Similarity:76/174 - (43%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 ILVFNTLIALFFNPLLLMTLLGVAG---GFLFPNGLPEMVSSTLRVLGQSFSATALFLLGL---- 292
            |:|:..||.   ||....:|.|:|.   .|.:...:|.::|.::.:|..:....|:|.|||    
plant   492 IMVWRKLIR---NPNTYSSLFGLAWSLVSFKWNIKMPTIMSGSISILSDAGLGMAMFSLGLFMAL 553

  Fly   293 --KIVGGTGSERKSIGFLLPGVLILVKILVLPLVIRQT-VNIMQSGQNFNDTTELSTFGFLYGTF 354
              ||:        :.|..:.|..:.|:.|..|.||..| :.|...|       :|.....:....
plant   554 QPKII--------ACGKSVAGFAMAVRFLTGPAVIAATSIAIGIRG-------DLLHIAIVQAAL 603

  Fly   355 PAAPGAFVIATQYNMEVELVARSMVFCTFISAPLMFISAKMISL 398
            |.....||.|.:||:..::::.:::|...::.|:..:...::.|
plant   604 PQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPVTVLYYVLLGL 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anchorNP_001261995.1 Mem_trans 53..387 CDD:304621 38/161 (24%)
DEP_GPR155 871..953 CDD:239890
EIR1NP_568848.1 Mem_trans 9..>190 CDD:308904
Mem_trans <486..646 CDD:328943 39/171 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.