DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anchor and PIN5

DIOPT Version :9

Sequence 1:NP_001261995.1 Gene:anchor / 39965 FlyBaseID:FBgn0036741 Length:957 Species:Drosophila melanogaster
Sequence 2:NP_197157.4 Gene:PIN5 / 831515 AraportID:AT5G16530 Length:351 Species:Arabidopsis thaliana


Alignment Length:383 Identity:81/383 - (21%)
Similarity:158/383 - (41%) Gaps:71/383 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ALVQCFGIIICGYIAGRFK---IISNAETKGLGTFVGTFALPSLIFLSLVELNWSAVNWSFLLAM 114
            |:|..:..:|.||  |..|   |.:..:...:...|..|.||.........::...:|:.|:.|.
plant    13 AMVPLYVALILGY--GSVKWWHIFTRDQCDAINRLVCYFTLPLFTIEFTAHVDPFNMNYRFIAAD 75

  Fly   115 LVSKAVVFFAVLIISLLVARPLNYARGGLMAIFCTQSNDFAIGYPIVMALYKDVHPEYASYLYLM 179
            ::|| |:...||.:....:...:|.........||.:|...:|.|:..|:|    .:.|..|.:.
plant    76 VLSK-VIIVTVLALWAKYSNKGSYCWSITSFSLCTLTNSLVVGVPLAKAMY----GQQAVDLVVQ 135

  Fly   180 APISLAIL-NPVGLVLMEISKI---IKNKEDVTRNPPLCPETCPAEQMSKRNRCLGERSILVFNT 240
            :.:..||: ..:.|.::|..|.   ..|..||.      .:....|...:....:||:|.|...:
plant   136 SSVFQAIVWLTLLLFVLEFRKAGFSSNNISDVQ------VDNINIESGKRETVVVGEKSFLEVMS 194

  Fly   241 LI--ALFFNPLLLMTLLGVAGGFL---FPNGLPEMVSSTLRVLGQSFSATALFLLGL-------K 293
            |:  .|..||.....:||:|..|:   :...||.::..::.::.::.:.||:|.:|:       .
plant   195 LVWLKLATNPNCYSCILGIAWAFISNRWHLELPGILEGSILIMSKAGTGTAMFNMGIFMALQEKL 259

  Fly   294 IVGGT-----GSERKSIGFLLPGVLILVKILVLPL---VIRQTVNIMQSGQNFNDTTELSTFGFL 350
            ||.||     |...|   |:.....:.:..:||.|   |:|  |.|:|:                
plant   260 IVCGTSLTVMGMVLK---FIAGPAAMAIGSIVLGLHGDVLR--VAIIQA---------------- 303

  Fly   351 YGTFPAAPGAFVIATQYNMEVELVARSMVFCTFISAPLMFISAKMISLTNLKPLDYLH 408
              ..|.:..:|:.|.:|.:..::::.:::|...:|.|::        :.....|:::|
plant   304 --ALPQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVL--------VAYYAALEFIH 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anchorNP_001261995.1 Mem_trans 53..387 CDD:304621 78/360 (22%)
DEP_GPR155 871..953 CDD:239890
PIN5NP_197157.4 Mem_trans 10..344 CDD:308904 79/374 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.