DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment anchor and PIN4

DIOPT Version :9

Sequence 1:NP_001261995.1 Gene:anchor / 39965 FlyBaseID:FBgn0036741 Length:957 Species:Drosophila melanogaster
Sequence 2:NP_849923.1 Gene:PIN4 / 814670 AraportID:AT2G01420 Length:616 Species:Arabidopsis thaliana


Alignment Length:143 Identity:36/143 - (25%)
Similarity:65/143 - (45%) Gaps:23/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YPALVQCFGIIICGYIAGRFKIISNAETKGLGTFVGTFALPSLIFLSLVELNWSAVNWSFLLAML 115
            |.|::..:|.:      ..:||.|..:..|:..||..||:|.|.|..:...:..|:|:.|:.|..
plant    18 YVAMILAYGSV------QWWKIFSPDQCSGINRFVAIFAVPLLSFHFISTNDPYAMNFRFVAADT 76

  Fly   116 VSKAVVFFAVLIISLLVARPLNYARGG----LMAIF--CTQSNDFAIGYPIVMALYKDVHPEYAS 174
            :.|       :|:.:|:|...|..:.|    ::.||  .|..|...:|.|:::|:|    ..||.
plant    77 LQK-------IIMLVLLALWANLTKNGSLEWMITIFSLSTLPNTLVMGIPLLIAMY----GTYAG 130

  Fly   175 YLYLMAPISLAIL 187
            .|.:...:...|:
plant   131 SLMVQVVVLQCII 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
anchorNP_001261995.1 Mem_trans 53..387 CDD:304621 35/141 (25%)
DEP_GPR155 871..953 CDD:239890
PIN4NP_849923.1 Mem_trans 9..>190 CDD:281537 36/143 (25%)
Mem_trans <453..611 CDD:281537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.