DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps60 and VPS60.1

DIOPT Version :9

Sequence 1:NP_001261994.1 Gene:Vps60 / 39964 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_187675.2 Gene:VPS60.1 / 820233 AraportID:AT3G10640 Length:235 Species:Arabidopsis thaliana


Alignment Length:233 Identity:101/233 - (43%)
Similarity:147/233 - (63%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            |.|:||..|..||.||:.|....::.|..::|:||..|:.||.||:||:.|.|.|||:.:||.:|
plant     1 MRRVFGAKKNTEPPPSIQDASDRINKRGDSVEDKIKKLDVELCKYKEQLKKTRPGPAQEAVKARA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            :|||||||.||.|.:.|.||:||::|.::||:.|||.|.|:.|:|...|::|...|.:.|..|::
plant    66 MRVLKQKKMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTMTALKSANKELKGMMKTVKIQDIDN 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPE-VDDDDLQAELDAL----GDEIALDDDTSYL------- 183
            :||:|.|:.:.:.|:||:|||:|.:|: :|:|||..|||||    |:|...|...|||       
plant   131 LQDEMMDLMDVSSEIQESLGRSYNIPDGLDEDDLMGELDALEADMGNETEADGMPSYLQPDTETD 195

  Fly   184 -DDVVKAPEAPSREPGADSIVPGKSTIETDEFGLPKIP 220
             |..:..|.||:...||..   |::..| ||||||.:|
plant   196 YDSELNLPAAPTGHNGAPH---GRAQAE-DEFGLPAVP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 87/201 (43%)
VPS60.1NP_187675.2 Snf7 1..195 CDD:419749 86/193 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 166 1.000 Domainoid score I1202
eggNOG 1 0.900 - - E1_KOG1655
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5757
Inparanoid 1 1.050 188 1.000 Inparanoid score I1396
OMA 1 1.010 - - QHG53573
OrthoDB 1 1.010 - - D1301560at2759
OrthoFinder 1 1.000 - - FOG0003367
OrthoInspector 1 1.000 - - otm3469
orthoMCL 1 0.900 - - OOG6_102352
Panther 1 1.100 - - LDO PTHR22761
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.