DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps60 and chmp5

DIOPT Version :9

Sequence 1:NP_001261994.1 Gene:Vps60 / 39964 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001016748.1 Gene:chmp5 / 549502 XenbaseID:XB-GENE-5962693 Length:219 Species:Xenopus tropicalis


Alignment Length:222 Identity:140/222 - (63%)
Similarity:172/222 - (77%) Gaps:3/222 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            ||||||:.|||.|..:|.|||:.||:|:.:|::|||.|:|||.||::||.||||||:||.|||||
 Frog     1 MNRLFGKSKPKVPPSTLTDCISNVDSRSESIDKKISRLDAELVKYKDQMKKMREGPSKNMVKQKA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            |||||||:.||||.::|..|||||||.|||.||||||:.||.|||.|.|:||..||::.||||||
 Frog    66 LRVLKQKRMYEQQRDNLNQQSFNMEQTNYAIQSLKDTKTTVDAMKVGAKEMKKAYKQVKIDQIED 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSR 195
            :||.:.||.|.|:|:||||.|:||.||:|:|||:|||||||||:.|||||||||:...||..|..
 Frog   131 LQDQLEDMMENANEIQEALSRSYGTPEIDEDDLEAELDALGDELLLDDDTSYLDEAASAPAIPEG 195

  Fly   196 EPGADSIVPGKSTIETDEFGLPKIPTS 222
            .|. ||  ..|..:..||||||:||.:
 Frog   196 VPN-DS--KNKDGVLVDEFGLPQIPAT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 125/188 (66%)
chmp5NP_001016748.1 Snf7 1..201 CDD:328813 131/202 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2114
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5757
Inparanoid 1 1.050 282 1.000 Inparanoid score I2821
OMA 1 1.010 - - QHG53573
OrthoDB 1 1.010 - - D1301560at2759
OrthoFinder 1 1.000 - - FOG0003367
OrthoInspector 1 1.000 - - oto102734
Panther 1 1.100 - - LDO PTHR22761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2003
SonicParanoid 1 1.000 - - X3249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.