DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps60 and CHMP5

DIOPT Version :9

Sequence 1:NP_001261994.1 Gene:Vps60 / 39964 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_057494.3 Gene:CHMP5 / 51510 HGNCID:26942 Length:219 Species:Homo sapiens


Alignment Length:222 Identity:140/222 - (63%)
Similarity:171/222 - (77%) Gaps:3/222 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLFGRGKPKEPGPSLNDCIAGVDARATNIEEKISNLEAELRKYREQMSKMREGPAKNSVKQKA 65
            ||||||:.|||.|.|||.|||..||:||.:|::|||.|:|||.||::|:.|||||||||.|||||
Human     1 MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKA 65

  Fly    66 LRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKKINIDQIED 130
            |||||||:.||||.::|..||||||||||..||||||:.||.|||.|||:||..||::.||||||
Human    66 LRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIED 130

  Fly   131 IQDDMADMFEQADEVQEALGRTYGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKAPEAPSR 195
            :||.:.||.|.|:|:||||.|:||.||:|:|||:|||||||||:..|:|:||||:...||..|. 
Human   131 LQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPE- 194

  Fly   196 EPGADSIVPGKSTIETDEFGLPKIPTS 222
              |..:....|..:..||||||:||.|
Human   195 --GVPTDTKNKDGVLVDEFGLPQIPAS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 126/188 (67%)
CHMP5NP_057494.3 Snf7 1..201 CDD:419749 130/202 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 14/19 (74%)
Interaction with VTA1 121..158 22/36 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..219 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147858
Domainoid 1 1.000 248 1.000 Domainoid score I2145
eggNOG 1 0.900 - - E1_KOG1655
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5757
Inparanoid 1 1.050 283 1.000 Inparanoid score I2877
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53573
OrthoDB 1 1.010 - - D1301560at2759
OrthoFinder 1 1.000 - - FOG0003367
OrthoInspector 1 1.000 - - oto88865
orthoMCL 1 0.900 - - OOG6_102352
Panther 1 1.100 - - LDO PTHR22761
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2003
SonicParanoid 1 1.000 - - X3249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.