DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps60 and CG5498

DIOPT Version :9

Sequence 1:NP_001261994.1 Gene:Vps60 / 39964 FlyBaseID:FBgn0036740 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster


Alignment Length:194 Identity:43/194 - (22%)
Similarity:92/194 - (47%) Gaps:24/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKEPGPSLNDCIAGVDARATNIE-------EKISNLEAELR----KYREQMSKMREGPAKNSVKQ 63
            ||:||..||  |:..|....|::       :::.:||.|::    |.|:.|.:.:...||..:::
  Fly   230 PKKPGDDLN--ISQEDQAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRK 292

  Fly    64 KALRVLKQKKAYEQQAESLRNQSFNMEQANYAAQSLKDTQATVAAMKDGVKQMKTEYKK--INID 126
            :.|    .:|.:|:::.:|.    |:|....:....:::...:.|.|.|...:|.....  :..|
  Fly   293 RHL----LEKNHERRSLALH----NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYD 349

  Fly   127 QIEDIQDDMADMFEQADEVQEALGRT-YGMPEVDDDDLQAELDALGDEIALDDDTSYLDDVVKA 189
            .::::..|:.|..:|..|||:.:..: ......:||.|:.||..|..|.|....:.::::.::|
  Fly   350 NVDEVLADVRDTLDQHREVQDIMSNSVVENASQEDDQLEQELRELAGESAPATFSPHINNNLRA 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps60NP_001261994.1 Snf7 1..190 CDD:304451 43/194 (22%)
CG5498NP_730525.2 Snf7 244..397 CDD:304451 32/160 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22761
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.