DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Elf1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:XP_006252409.1 Gene:Elf1 / 85424 RGDID:620697 Length:623 Species:Rattus norvegicus


Alignment Length:228 Identity:107/228 - (46%)
Similarity:129/228 - (56%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 HAGQHTHSTIAAAAAAAAA--------------SVVSSSSSAVAA-----AAMLSASAAAAAT-- 728
            |.|..|..||.||.|....              ::.|||...:.|     :..|........|  
  Rat    90 HNGDETIETIGAAEALLNMDSPGPVLDEKRINNNIFSSSEDDIVAPITHVSVTLDGIPEVMETQQ 154

  Fly   729 ---AAAAAGGSQSVIQPATSSVSYDLSYMLELGGFQQRKAKKPR------KPKLEMGVKRRSREG 784
               :.|.:.|:.|..||.....:       .|....:||.|.||      .|.:.:..|.:..:|
  Rat   155 VQESNADSPGASSPEQPKRKKGA-------SLTCLGRRKTKPPRPDSPATTPNISVKKKSKDGKG 212

  Fly   785 STTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRY 849
            :|.|||||||.||||:..||::||||.||||:||||||||||||||.||||||||||||||||||
  Rat   213 NTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRY 277

  Fly   850 YYQRGILAKVDGQRLVYQFVDVPKDIIEIDCNG 882
            ||||||||||:||||||||.::|||:|.||..|
  Rat   278 YYQRGILAKVEGQRLVYQFKEMPKDLIYIDDEG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 69/79 (87%)
Elf1XP_006252409.1 Elf-1_N 2..111 CDD:403506 8/20 (40%)
ETS 214..296 CDD:197710 70/81 (86%)
rne <359..539 CDD:236766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4132
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44884
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11849
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.