DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and elf1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001072854.1 Gene:elf1 / 780315 XenbaseID:XB-GENE-492875 Length:632 Species:Xenopus tropicalis


Alignment Length:217 Identity:101/217 - (46%)
Similarity:132/217 - (60%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   685 HAGQHTHSTIAAAAA-------------AAAASVVSSSSSAVAAAAMLSASAAAAATAAAAAGGS 736
            |.|..|..||.||.|             ...|::..|:...:.:..:...|        ....|.
 Frog    89 HNGDETMETIEAAEALLNIDSPDPMLDEKRLANIFGSADDDLLSTPVTHVS--------VTVDGI 145

  Fly   737 QSVIQPATSSVSYDLSYMLELGGFQQRKAKKPRKPKLE-------MGVKRRSRE--GSTTYLWEF 792
            ..|::...:....:|...|.... :::|.:|||.|:.|       :.||:::::  |:|.|||||
 Frog   146 PEVMEIHQNIYEENLESNLHEQP-KRKKGRKPRNPRPESPTTTPNISVKKKNKDGKGNTIYLWEF 209

  Fly   793 LLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILA 857
            ||.||||:..||::||||.||||:||||||||||||||.||||||||||||||||||||||||||
 Frog   210 LLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILA 274

  Fly   858 KVDGQRLVYQFVDVPKDIIEID 879
            ||:||||||||.::|||::.||
 Frog   275 KVEGQRLVYQFKEMPKDLVYID 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 69/79 (87%)
elf1NP_001072854.1 Elf-1_N 2..110 CDD:372034 8/20 (40%)
ETS 203..285 CDD:197710 70/81 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47927
Panther 1 1.100 - - LDO PTHR11849
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.