DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and spdef

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001072412.1 Gene:spdef / 779866 XenbaseID:XB-GENE-491205 Length:317 Species:Xenopus tropicalis


Alignment Length:90 Identity:46/90 - (51%)
Similarity:63/90 - (70%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   781 SREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGR 845
            |..|...:||:||.:||.......|.|:|.|:|||:||:.||..|:||||:.||:|.|||:.:.|
 Frog   225 SGSGQPIHLWQFLKELLLKPHSYGRSIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSR 289

  Fly   846 ALRYYYQRGILAKVD-GQRLVYQFV 869
            ::|.||::||:.|.| .||||||||
 Frog   290 SIRQYYKKGIIRKPDVSQRLVYQFV 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 42/80 (53%)
spdefNP_001072412.1 SAM_PNT-PDEF-like 114..194 CDD:188878
ETS 230..317 CDD:197710 44/85 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D388142at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.