DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and ehf

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001034911.1 Gene:ehf / 568223 ZFINID:ZDB-GENE-060312-7 Length:289 Species:Danio rerio


Alignment Length:120 Identity:51/120 - (42%)
Similarity:72/120 - (60%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   749 YDLSYMLELGGFQQRKAKKPRKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNRE 813
            :|:....:........|.....||... |||.:..|  |:||||:..:|.:.|..|..|||.:|.
Zfish   161 FDIKSSFQPSSILPSPAPSSPDPKRSQ-VKRHNPRG--THLWEFIRDILLNPERNPGLIKWEDRS 222

  Fly   814 KGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQF 868
            :|||:.:.|:||::|||..||...|.||.:.||:||||:|.||.:|||:||||:|
Zfish   223 EGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 42/80 (53%)
ehfNP_001034911.1 SAM_PNT-ESE-3-like 43..121 CDD:188882
ETS 195..282 CDD:197710 44/85 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.