DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Elf4

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001368805.1 Gene:Elf4 / 56501 MGIID:1928377 Length:655 Species:Mus musculus


Alignment Length:125 Identity:84/125 - (67%)
Similarity:98/125 - (78%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 QQRKAKKPRK------PKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKL 819
            :.||.|..|.      |.:.:..|.:..:|||.|||||||.|||||..||::||||.||||:|||
Mouse   176 RNRKTKNNRSTSPVTDPSMPIRKKSKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKL 240

  Fly   820 VDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDIIEID 879
            |||||||:|||..|||||||||||||||||||||||||||:||||||||.::|||::.||
Mouse   241 VDSKAVSKLWGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVID 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 68/79 (86%)
Elf4NP_001368805.1 Elf-1_N 2..103 CDD:403506
RUNX1-binding. /evidence=ECO:0000250|UniProtKB:Q99607 86..205 6/28 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..202 6/25 (24%)
Ets 209..289 CDD:395126 68/79 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..362 84/125 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..512
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4218
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42817
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.