DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and erfl1

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:XP_009290629.1 Gene:erfl1 / 558126 ZFINID:ZDB-GENE-090529-3 Length:473 Species:Danio rerio


Alignment Length:96 Identity:44/96 - (45%)
Similarity:55/96 - (57%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   774 EMGVKRRSREGS-TTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPD 837
            |...|..|..|| ...||.|:|:|||..|| ...|.|.. :.|.|.:.|...|:||||:.|.||.
Zfish    27 EWAYKPESSPGSRQIQLWHFILELLQKEEY-QGVIAWQG-DYGEFVIKDPDEVARLWGIRKCKPH 89

  Fly   838 MNYETMGRALRYYYQRGILAKVDGQRLVYQF 868
            |||:.:.|||||||.:.||.|..|:|..|:|
Zfish    90 MNYDKLSRALRYYYNKRILHKTKGKRFTYKF 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 39/80 (49%)
erfl1XP_009290629.1 ETS 40..122 CDD:197710 39/83 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.