DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and ETV7

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_057219.1 Gene:ETV7 / 51513 HGNCID:18160 Length:341 Species:Homo sapiens


Alignment Length:130 Identity:46/130 - (35%)
Similarity:76/130 - (58%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 SYDLSYMLELGGFQQRKAKKPRKPKLEMGVKRRSREGSTTYLWEFLLKLLQDREYCPRFIKWTNR 812
            |.:|.:..|||...|.....|..|:..:.    .|......||:::.:||.|..|.| :|||.::
Human   189 SLNLCHCAELGCRTQGVCSFPAMPQAPID----GRIADCRLLWDYVYQLLLDTRYEP-YIKWEDK 248

  Fly   813 EKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYYYQRGILAKVDGQRLVYQFVDVPKDIIE 877
            :..:|::||...::||||.|||:.:|.||.|.||||:||:..|:.|..||:|:::|:..|..:::
Human   249 DAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQ 313

  Fly   878  877
            Human   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 35/79 (44%)
ETV7NP_057219.1 SAM_PNT-Tel_Yan 49..116 CDD:176085
ETS 223..308 CDD:197710 36/85 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.