DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Spib

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:XP_006229173.1 Gene:Spib / 499146 RGDID:1565899 Length:287 Species:Rattus norvegicus


Alignment Length:215 Identity:53/215 - (24%)
Similarity:82/215 - (38%) Gaps:65/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   663 PHSQLNGPHPHSHPHSHPHSHPHAGQHTHSTIAAAAAAAAASVVSSSSSAV---AAAAMLSASAA 724
            |..:.:||....:|         :...|..|:.:.|.|...|.|.|....:   :.|..:|.|.:
  Rat   118 PSLEASGPGLQVYP---------SEDFTSQTLGSLAYAPYPSPVLSEEEDILLDSPALEVSDSES 173

  Fly   725 AAATAAAAAG-GSQSVIQPATSSVSYDLSYMLELGGFQQRKAKKPRKPKLEMGVKRRSREGSTTY 788
            ..|..|.:.| ||                                     |.|.:::.|      
  Rat   174 DEALLAGSEGRGS-------------------------------------EAGARKKLR------ 195

  Fly   789 LWEFLLKLL--QDREYCPRFIKWTNREKGVFKLVD--SKAVSRLWGMHK-NKPDMNYETMGRALR 848
            |::|||:||  .|...|   :.|.....|||:...  .:.::|.||..| |:..|.|:.:.||||
  Rat   196 LYQFLLELLLRGDMREC---VWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALR 257

  Fly   849 YYYQRGILAKVDGQRLVYQF 868
            .|.:.|.:.||. ::|.|||
  Rat   258 NYAKTGEIRKVK-RKLTYQF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 31/85 (36%)
SpibXP_006229173.1 ETS 193..281 CDD:197710 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.