DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and Ets97D

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:161 Identity:59/161 - (36%)
Similarity:77/161 - (47%) Gaps:42/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 QQRKAKKPR-------------KPKLEMGVKRRSREG--------STT----------------- 787
            :|||.|:||             ...||..:.|:|.:.        |||                 
  Fly   280 EQRKPKQPRIMSANSISTNSGGSLSLEQRIMRKSYQSVKSSDSVESTTSSMNPSNYTTIGSGNNG 344

  Fly   788 --YLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRYY 850
              .||:|||::|.|.|:.. .|:|...| |.|||.|...|:||||..||||.||||.:.||||||
  Fly   345 QVQLWQFLLEILTDCEHTD-VIEWVGTE-GEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYY 407

  Fly   851 YQRGILAKVDGQRLVYQFVDVPKDIIEIDCN 881
            |...:::||.|:|..|:|....|.:|..|.|
  Fly   408 YDGDMISKVSGKRFAYKFDCDLKLLIGYDAN 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602 41/79 (52%)
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084
ETS 345..429 CDD:197710 42/85 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.