DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip74EF and saxo2

DIOPT Version :9

Sequence 1:NP_001014590.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster
Sequence 2:NP_998882.1 Gene:saxo2 / 407955 XenbaseID:XB-GENE-1008144 Length:471 Species:Xenopus tropicalis


Alignment Length:149 Identity:30/149 - (20%)
Similarity:55/149 - (36%) Gaps:23/149 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 CERARMRLKPERKAERSAAYKKSLMKRY---YTEIPIVKQSTSPAPQQQLQQQHHLQQQQQQQPH 380
            |.|.|....|....|:|.  |:.::..|   |.:...|:...|..|:|:...:|           
 Frog    12 CGRHRCPHNPTHITEKSG--KQCVLTEYVEKYPQYDNVQPPKSMKPKQEYSGEH----------- 63

  Fly   381 NGSTFAGATALLHIKTEQNTLLTPLQLQQQQQQQQGLHGAAGNGGSSNGNNAHQQQQPLAIPQRP 445
              ....|.|...........|..|::..::.|.:.   |:...|.:.|.:....:.:|:| |.||
 Frog    64 --GRMEGITTFKSDYVPYEILNRPVRAHEEYQPKP---GSIELGTTYNRDYNPHRLEPVA-PIRP 122

  Fly   446 LLHNLLSGGAIH-NPHHRN 463
            :.....:.|... ||.:::
 Frog   123 VDKGQANPGRFDTNPTYKD 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip74EFNP_001014590.1 Ets 789..869 CDD:278602
saxo2NP_998882.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4136
eggNOG 1 0.900 - - E1_KOG3804
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006321
OrthoInspector 1 1.000 - - otm47927
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.